KEGG   Saccharophagus degradans: Sde_1529
Entry
Sde_1529          CDS       T00335                                 

Definition
(GenBank) Uncharacterised conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
sde  Saccharophagus degradans
Brite
KEGG Orthology (KO) [BR:sde00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sde02044]
    Sde_1529
Secretion system [BR:sde02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sde_1529
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABD80791
UniProt: Q21KI8
Position
1973009..1973512
AA seq 167 aa
MESIHKKLSRVRKPRVHISYDVETEGATVQKELPFVVGVMGDFSGDPTAPLKALKDRRFV
QIDRDNFDEVLKSMTPGLSIQVNNTLKNDGSQFAVDLKFESMDDFEPGAIVNQVEPLKKL
LDTRNKLRDLSTKADRSEELEGILERILNNEADLGELAEAVGADKES
NT seq 504 nt   +upstreamnt  +downstreamnt
atggaaagcatacataaaaagttaagtcgagttagaaagcctcgggttcacattagttac
gatgtggaaaccgaaggggctacagtacaaaaggaattgccatttgttgtaggcgtaatg
ggcgatttttctggcgacccaactgcaccgttaaaagcgttaaaagatcgccggtttgtg
cagatagaccgagataattttgatgaagtgcttaaaagcatgactccaggattgtcaatt
caagtaaataacaccttgaaaaacgacggcagccaattcgcggtagatttgaaatttgaa
tctatggatgactttgaaccaggcgccattgtgaaccaggtagagccacttaaaaaattg
ttggatacgcgtaataaattacgcgacttatcaaccaaagcagaccgttctgaagaatta
gaaggcattttagagcgtatattgaataacgaagctgatcttggcgaattagccgaagcg
gttggcgcagacaaggagtcctaa

DBGET integrated database retrieval system