KEGG   Saccharophagus degradans: Sde_1605Help
Entry
Sde_1605          CDS       T00335                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sde  Saccharophagus degradans
Pathway
sde00071  Fatty acid degradation
sde00280  Valine, leucine and isoleucine degradation
sde00281  Geraniol degradation
sde00310  Lysine degradation
sde00362  Benzoate degradation
sde00380  Tryptophan metabolism
sde00410  beta-Alanine metabolism
sde00640  Propanoate metabolism
sde00650  Butanoate metabolism
sde00903  Limonene and pinene degradation
sde00930  Caprolactam degradation
sde01040  Biosynthesis of unsaturated fatty acids
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
sde01212  Fatty acid metabolism
Module
sde_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sde_1605
   00650 Butanoate metabolism
    Sde_1605
  Lipid metabolism
   00071 Fatty acid degradation
    Sde_1605
   01040 Biosynthesis of unsaturated fatty acids
    Sde_1605
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sde_1605
   00310 Lysine degradation
    Sde_1605
   00380 Tryptophan metabolism
    Sde_1605
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sde_1605
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sde_1605
   00281 Geraniol degradation
    Sde_1605
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sde_1605
   00930 Caprolactam degradation
    Sde_1605
Enzymes [BR:sde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sde_1605
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sde_1605
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sde_1605
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Sde_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABD80867
UniProt: Q21KB2
Position
2061835..2064000
Genome map
AA seq 721 aa AA seqDB search
MKFEGQAIRLTPLDNGCVELNFDLQGESVNKFGQTVFKDLAEVLDLLESAKDVKGVLVTS
AKSVFFVGADINEFGPIFAKGEEAIIEGVSSVNKLFSRFEDLPFPSVVAINGYALGGGLE
FCLACDYRVMSTAAKIGLPETKLGIIPGWGGTVRLSRVAGVDVAVEWIAGGTENRPDAAL
KAGVVDGIVEPENLRDAALKVLADAVAGDLEITQRRAKKKGPLKHNDIESLLAFESSKAF
VKAKAGRNYPAPIAAIESMQHGAKLGRDEAIPVETKLFAKMALTSVAESLIGLFQSDQLL
GKKAKNWEKQSDKKVEHAAVLGAGIMGGGIAYQSAYRGVPIKMKDIAAAGVELGLKEATK
LLAKRVDRGRMTNLEMGQVLSRIDGTLSYDNFDDVDVVVEAVVENPKVKRAVLAEVEDKI
STDAILCSNTSTISISYLGEALKRPENFCGMHFFNPVHAMPLVEVIRGAKTSDRAIARTV
AYANALGKKAIVVNDCPGFLVNRVLFPYFAGFAMLLRDGADFQQVDKVMERWGWPMGPAY
LMDVVGIDTGVHAESVMAEGFPDRMAKTFKAASDILFESGRLGQKSDLGFYAYKEDKKGK
PQKVMAEDTYELLKPHCAERKEFSDEEIIARMMVPMATELARCLEEGVVSSAAEADMALI
YGLGFPPFRGGVFRWIDSIGIQAFIDMAAPLADLGLVYVPTDGMKALAAKNAKYYNQTQG
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaaggtcaggcaatacggcttacaccgctagataatggctgtgtagagctc
aactttgacttgcagggtgagtcggttaataagtttggtcaaactgtgtttaaagatctt
gccgaggtgctcgatctccttgaatccgctaaagatgtaaaaggggtgttggttactagc
gccaagagtgtgttttttgtgggcgcagacataaacgaatttggccccatcttcgccaag
ggtgaagaggccattatcgaaggggtaagcagtgttaataagctgtttagccggttcgaa
gacttgccattcccttcggtagtggcaattaatggctatgccttaggcggtggtttagag
ttttgtttggcgtgcgattaccgtgtaatgagcactgccgctaaaataggcttgcccgaa
accaagttgggtattattcctggttggggtggtactgtgcgcttgtctcgtgttgcgggt
gtcgacgtggcagtggaatggattgccggcggcaccgaaaacagaccagatgctgcatta
aaagcaggcgtagtagatggtattgtagaacctgaaaacctgcgcgacgccgctttaaaa
gtgcttgccgatgctgttgctggtgatctagaaattactcagcgcagagctaagaaaaaa
ggccccttaaaacataacgatattgaaagcctcctcgcttttgaatcttccaaggccttt
gttaaagcaaaagctggtcgcaactacccagccccaatcgccgcaattgaatctatgcaa
catggtgccaagctagggcgcgatgaggctattcctgtagagactaagctgtttgcgaaa
atggcgcttactagtgtggcagaatcgttaataggtttattccaaagcgatcagctatta
ggtaaaaaagctaaaaattgggaaaagcaatcagacaaaaaagtagagcatgcagccgta
ttgggcgcgggcattatgggtggtggtatagcttatcagtctgcctaccgtggcgtgccc
attaaaatgaaagacattgccgcagcgggtgtggagctgggcttaaaagaagccaccaag
cttcttgcgaagcgcgtcgatagggggcgcatgaccaacctagaaatggggcaagtacta
agccgcattgatggaactttaagctacgacaattttgacgatgtagatgtagtggtggaa
gctgttgttgaaaacccaaaggtgaagcgcgcagttttggctgaagtggaagacaaaata
agcaccgatgctattttgtgttcaaacacttctactatttctatctcttatttaggtgaa
gcattaaagcggccagaaaatttctgcggaatgcacttttttaacccagtgcacgccatg
ccgttagttgaagttattcgcggtgctaaaacctctgatagagcaatagcaagaacagtg
gcctatgccaatgcattaggtaaaaaagcaattgttgttaacgattgccctggcttttta
gtcaaccgagtattgttcccttattttgctggattcgcgatgttgctgcgcgatggagca
gattttcagcaagtagataaagtcatggagcgctgggggtggccaatgggcccggcttac
cttatggatgttgtgggtattgatactggtgtacatgccgaatccgtaatggctgagggg
tttccagatcgtatggcaaaaacctttaaagctgcgtctgatattttgtttgaatctggc
cgcttagggcagaagagcgacttaggtttttacgcgtataaagaagataaaaaaggtaag
ccgcaaaaagtaatggcggaagacacttacgagttgcttaaacctcactgcgcagaacgc
aaagagtttagcgacgaggaaattattgcgcgcatgatggtgccaatggcaactgaactt
gcgcgctgcttggaagagggggttgtgagcagtgccgctgaagctgatatggcgcttatt
tacggcttaggtttccctccattccgtggtggtgtattccgttggatagacagcattggt
attcaagcgtttatcgatatggctgcgccgctggccgatttagggttggtttacgttcca
actgatggaatgaaagccctagccgcaaaaaatgcaaaatattacaaccagacccaagga
gcctaa

DBGET integrated database retrieval system