KEGG   Saccharophagus degradans: Sde_2572Help
Entry
Sde_2572          CDS       T00335                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sde  Saccharophagus degradans
Pathway
sde00010  Glycolysis / Gluconeogenesis
sde00020  Citrate cycle (TCA cycle)
sde00620  Pyruvate metabolism
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
Module
sde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_2572
   00020 Citrate cycle (TCA cycle)
    Sde_2572
   00620 Pyruvate metabolism
    Sde_2572
Enzymes [BR:sde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sde_2572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H E3_binding RnfC_N HlyD_D23 NQRA HlyD_3 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ABD81832
UniProt: Q21HJ7
Position
complement(3263232..3265145)
Genome map
AA seq 637 aa AA seqDB search
MAKQIINVPDIGGADNVDIIEICVAVGDTVSAEDSLLVLESDKASMEVPSPVSGKVVGIL
VKEGGKVSEGDAIFEIEAEGAADAPAAEPAAAPAAAPAPEAAAPAASSEQLVKVPDIGGS
ENVEVIELCVAVGDEVAEGDSIIVLESDKASMEVPAPASGKVVSFAIKEGDKLSEGDDIL
VLEVSGGAAAPAAAPAESAPVAAAPAPAPAASGGVTDVNVPDIGGSENVEVIEVCVAEGD
EISEGDSIVVLESDKASMEIPSPASGKVVSITVKEGDKVSEGAALLKLEIVGAAPAAAPA
PAAAPAAPQAPAKPVEQPVKTTQELHPAEVSATTGEVYAGPAVRKLARQLGVNLSEVKPT
GPRKRHTKDDVREFVKTVMKQRSTGGAAVTGGSGIPAVPAVDFSQFGEIEMQKMSKIKKV
TAAAMVRNWLNVPHVTQFDDADITELEAFRKNMKAEAEAAGVKLTPLPFLLKACAAALKA
EPSFNVSMHPDGEHIVQKKYIHIGMAVDTPNGLVVPVIRDVDKKGLFELAAETVALAKKA
RDGKLMPKDMQGGCFTISSLGPIGGTGFTPIVNAPEVAILGVSKADIKPRWNGKEFEPRQ
MLPLCLSYDHRAINGGDAGRFFTFLSAVLSDVRRLLL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
gtggctaagcaaattatcaacgtcccagatattggtggggcggacaacgtagatattatt
gagatatgtgttgctgtaggcgataccgtttctgctgaagactctttgcttgttttagaa
tcagataaggcctctatggaagtgccttcgcctgtttctggtaaagtggttggcattctt
gttaaagagggcggtaaagtttctgaaggcgatgccatatttgaaattgaagcagagggc
gcagctgatgcgcctgctgctgaaccggcagccgctcctgcggcggcgccagccccagag
gcggctgcacctgcagcatcttctgagcagttggtgaaggttccagatattggtggttcc
gaaaacgttgaagtgatcgagttatgtgttgctgtgggcgatgaggttgccgaaggcgat
tccattatcgtgctagaaagcgacaaggcttcaatggaagtgcctgcgccagcaagcggt
aaagtggttagctttgctatcaaagaaggcgataagctttctgaaggcgacgatattctt
gtgttagaagtaagtggtggcgcagctgcaccagctgccgctcctgctgagtctgctcct
gtagccgcggcccctgcacctgcacctgctgcaagtggcggtgtgaccgatgtaaatgtt
cctgacattggcggctcagaaaacgttgaagttatcgaagtttgcgttgcagaaggcgat
gaaattagcgaaggcgactccattgttgtgttggaaagcgataaagcatccatggagatc
ccatcacctgctagcggtaaagttgtaagcattaccgttaaagaaggcgataaagtatct
gaaggtgcggcactgcttaaattagaaattgttggtgctgcccctgctgcagctcctgcg
cctgctgcggcacccgcagcgccacaagcgcctgctaagcctgttgagcagccagtgaag
accacgcaagagttacaccctgcggaagtgtctgccactactggtgaagtgtatgccggc
cctgcagtacgcaagttagcgcgtcagttaggtgtaaacctttcagaagtgaagccaacc
ggccctcgtaagcgtcatactaaagacgatgtacgcgagtttgttaaaactgtaatgaag
caacgcagcactggcggcgcagcagttacaggtggttcgggtattcctgcagtaccagca
gtagatttttctcagttcggcgagatcgaaatgcagaaaatgagcaaaatcaaaaaggtt
accgctgctgcaatggttcgcaactggttgaacgtgccacacgttactcagttcgacgat
gctgatattaccgagcttgaagcattccgtaagaacatgaaagcagaagccgaagcggca
ggtgtgaagttaacaccattaccgttcctgctaaaagcttgtgcggcagcgcttaaagcg
gagcctagctttaatgtttctatgcacccagacggcgagcatattgtgcagaagaaatac
atccacattggtatggctgtagatacgccaaacggtttggttgtacctgttattcgcgac
gtagacaaaaaaggtttgttcgaacttgcggctgaaacagtagctttagctaagaaagcg
cgcgatggtaagttgatgcctaaagatatgcagggcggatgttttactatttctagcctt
ggcccaattggcggtactggttttaccccaattgtgaacgcgcctgaagttgctattttg
ggtgtttctaaagcggatattaaaccgcgttggaacggtaaagagtttgagcctcgtcag
atgttgcctttgtgcttatcttacgatcaccgtgcaattaacggtggtgatgcaggtcgc
ttctttacgttcttatctgcagtattgtctgatgtgcgtcgcttactcctttaa

DBGET integrated database retrieval system