KEGG   Saccharophagus degradans: Sde_3149Help
Entry
Sde_3149          CDS       T00335                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sde  Saccharophagus degradans
Pathway
sde00071  Fatty acid degradation
sde00072  Synthesis and degradation of ketone bodies
sde00280  Valine, leucine and isoleucine degradation
sde00310  Lysine degradation
sde00362  Benzoate degradation
sde00380  Tryptophan metabolism
sde00620  Pyruvate metabolism
sde00630  Glyoxylate and dicarboxylate metabolism
sde00640  Propanoate metabolism
sde00650  Butanoate metabolism
sde00900  Terpenoid backbone biosynthesis
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
sde01212  Fatty acid metabolism
sde02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sde_3149
   00630 Glyoxylate and dicarboxylate metabolism
    Sde_3149
   00640 Propanoate metabolism
    Sde_3149
   00650 Butanoate metabolism
    Sde_3149
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sde_3149
   00072 Synthesis and degradation of ketone bodies
    Sde_3149
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sde_3149
   00310 Lysine degradation
    Sde_3149
   00380 Tryptophan metabolism
    Sde_3149
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sde_3149
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sde_3149
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sde_3149
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sde04147]
    Sde_3149
Enzymes [BR:sde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sde_3149
Exosome [BR:sde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sde_3149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABD82406
UniProt: Q21FX3
Position
complement(4024154..4025332)
Genome map
AA seq 392 aa AA seqDB search
MSDPIVIVGIARTAMGGMQGMFSDVSAPQLGAQAIKGALEDAGLATSDVSEVFMGCVLPA
GTGQAPARQAALGAGLDKGVPTTTVNKVCGSGMKTVMMGCQAILAGEAEVVVAGGMESMT
NAPYMLTKARGGYRLGHGQVMDHMFLDGLQDAYEGELMGNFAEATASKYGFTREAQDAFA
IESLARANKAINEGKFKREITPFTLKTRKGETVIDTDEQPGNARPDKIPSLRPAFSKDGT
VTAANSSSISDGAAALVLMKQSTAQAKGLKPIAKITGYTQHAHEPEWFTTAPVGAVKNLL
EKTNWSASDVDLFEINEAFAVVSMAAMHDLELDHAKVNVNGGACALGHPLGASGARVLVT
LIAALQNESKKTGVAALCIGGGEAVAMAVELI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacccgattgttatcgtaggtatagcgcgcacagccatgggcggtatgcagggt
atgttttctgatgtaagtgcaccacaattaggcgcgcaagcgataaagggcgcattagag
gacgcaggcctagctacgagtgatgtaagtgaagtgtttatgggttgtgttttaccagcc
ggcacagggcaggcgccagcgcggcaagcggctttgggcgcagggcttgataaaggtgta
cccactaccactgttaacaaagtgtgtggctcgggcatgaaaactgtgatgatgggctgc
caggctattttggcgggtgaggccgaggtggttgtagccggtggtatggagagcatgacc
aacgcaccctatatgcttactaaggcacgtggcggttatcgcttggggcacggccaagtg
atggatcacatgtttttagatggcttgcaagatgcgtacgaaggtgagttaatgggtaac
tttgcagaagctacggcaagtaagtatggctttactcgcgaagcgcaagatgcattcgca
attgaatcgctcgcgcgcgctaataaggcgattaacgaaggcaaatttaagcgagaaatt
accccctttacgttaaaaacacgcaaaggtgaaaccgtgatagacaccgacgagcagccg
ggcaatgcgcgtccagataaaatcccaagtttgcgcccagcattctcaaaagatggcact
gtaacagccgctaactcaagctcaatttccgatggtgcggcagcattggtgttaatgaag
cagagcaccgcacaagcaaaagggttaaagcccattgccaaaattaccggttatacgcaa
cacgcccacgagccagagtggtttactaccgcgccagtgggagcggttaaaaacttgcta
gaaaaaacaaactggtctgcaagcgatgtggacttgtttgaaattaacgaggcgttcgcg
gtggtaagtatggctgcgatgcacgatttagagttggaccacgccaaggtaaatgttaat
ggcggcgcttgtgcattgggtcacccgctgggtgcatcgggtgcgcgcgtattggttaca
ctcattgcagcgctgcaaaacgagagtaaaaagactggagttgccgccctgtgtattggt
ggtggtgaagcggtagcaatggctgttgagctgatctaa

DBGET integrated database retrieval system