KEGG   Saccharophagus degradans: Sde_3666Help
Entry
Sde_3666          CDS       T00335                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sde  Saccharophagus degradans
Pathway
sde00860  Porphyrin and chlorophyll metabolism
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
Module
sde_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sde_3666
Enzymes [BR:sde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sde_3666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABD82921
UniProt: Q21EF8
Position
complement(4648623..4649495)
Genome map
AA seq 290 aa AA seqDB search
MTTNSGAIRIIASRPVAQNSEWCKRIEMFNSEAVWRALPIPLLEIIPVTGEAEKRQLQTQ
ALGLDDYQKILFVSQNAVEHFFTCLEDYWPQLPKQLCFIGVGEKTKQAILQQLDRWGCAG
DQIVLGGVDAMNSEALLAMPELQQVDAEKILICRGVGGRPMLGEILVARGARIEYCELYQ
RALPKQAVAVLAEADLNSTTDICPVFSGETLTNLVAVLAKHSNPRASEKPPFRLPAQWRA
LIVVVPGERVAQHAKAVGFKRIAVAKNATEPAMLKAIQQAVEEYLSTAAH
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaatagtggtgcaatacgcataattgcaagccggcctgtcgcgcaaaatagc
gaatggtgtaagcgcatagaaatgtttaatagcgaggctgtttggcgggcgctgcccatt
cccttacttgaaattattccggttacgggtgaggcagaaaaacggcagctacaaacccaa
gcgctaggtttagatgactatcaaaaaatactttttgtaagccaaaacgccgtagaacat
ttttttacctgcttagaagattattggccgcaactgccaaagcaactttgctttattggg
gtgggtgaaaaaaccaagcaggcaatattgcagcagctagatcgctggggctgtgctggc
gaccaaattgtattgggtggcgtagatgccatgaactccgaagcgttactcgccatgccc
gaattacagcaagtagacgctgaaaaaatattaatatgccgcggtgttggtggccggccc
atgttgggtgaaatattagtggctcgcggcgcacgcatagaatattgcgagttgtaccag
cgcgccttgccaaagcaagcagtagcggtattggctgaggccgacttaaatagcacaacc
gatatttgccccgtgtttagtggcgaaaccctaaccaacttagtggcggttttagctaaa
catagcaacccaagggcaagtgaaaagccaccgtttaggctgcctgcgcaatggcgagca
ttaattgttgtggtgcccggtgaacgcgtggcgcaacacgcaaaagccgtgggctttaag
cgtatagcggtggcaaaaaatgctaccgagccggcaatgcttaaggccatacagcaggcc
gtagaagaatatttaagtacagcagcgcactaa

DBGET integrated database retrieval system