KEGG   Steroidobacter denitrificans: ACG33_03505Help
Entry
ACG33_03505       CDS       T04296                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf00071  Fatty acid degradation
sdf00280  Valine, leucine and isoleucine degradation
sdf00310  Lysine degradation
sdf00362  Benzoate degradation
sdf00380  Tryptophan metabolism
sdf00620  Pyruvate metabolism
sdf00630  Glyoxylate and dicarboxylate metabolism
sdf00640  Propanoate metabolism
sdf00650  Butanoate metabolism
sdf00900  Terpenoid backbone biosynthesis
sdf01100  Metabolic pathways
sdf01110  Biosynthesis of secondary metabolites
sdf01120  Microbial metabolism in diverse environments
sdf01130  Biosynthesis of antibiotics
sdf01200  Carbon metabolism
sdf01212  Fatty acid metabolism
sdf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACG33_03505
   00630 Glyoxylate and dicarboxylate metabolism
    ACG33_03505
   00640 Propanoate metabolism
    ACG33_03505
   00650 Butanoate metabolism
    ACG33_03505
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACG33_03505
   00072 Synthesis and degradation of ketone bodies
    ACG33_03505
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACG33_03505
   00310 Lysine degradation
    ACG33_03505
   00380 Tryptophan metabolism
    ACG33_03505
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACG33_03505
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACG33_03505
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACG33_03505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdf04147]
    ACG33_03505
Enzymes [BR:sdf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACG33_03505
Exosome [BR:sdf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACG33_03505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AMN46185
UniProt: A0A127F9B2
Position
complement(809459..810670)
Genome map
AA seq 403 aa AA seqDB search
MRRAAIVSPVRTGVGTFGGSLRPVPVEELAASVIRAVLARTGLDPARIDDVVMAQSYANS
ETPCIGRWAALQAGLPIEVPGMQLDRRCGGGLQAVIAAAMMVQTGAADVVLVGGVESMSN
IEYYTTDMRWGARAGSVKLHDRLDRGRERSQPVERFGPISGMIETAENLAREHGISREEA
DAYAARSHHRARDAWAAGRFDAEVIPVSVPQKKGATLAFARDEGIRPDTSRESLAALRPL
IKGGTVTAGNSSQQNDAAAACLVVAEEKLSSLRLEPMGFLIDWAAAGCDPATMGYGPVPA
VAKLLRRTGLSLDHMDLVELNEAFACQVLAVLKGWGWNDPDRLNVNGSGISLGHPIGATG
VRILATLLHELARRGGRYGLETMCIGGGQGLAAIFERAGQAAG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagcagccatcgtaagccccgtacgcacgggtgtcggcaccttcggcggcagc
ctgcgtccggtccctgtcgaggagttggcggcgagtgtgattcgcgccgtcctcgcccgc
accggtctggatccggcgcgcatcgacgatgtggtgatggcgcaatcctatgccaatagc
gagacgccctgtatcggccgctgggcggcgctgcaggcggggctgcccatcgaagtgccg
ggcatgcagctcgatcgccgctgcggcggcgggctgcaggcggtcatcgccgcggcgatg
atggtgcagaccggcgccgccgacgtggtgctggtcggcggcgtggagagcatgagcaat
atcgagtactacaccaccgacatgcgctggggtgcccgcgccggctcggtcaagctgcac
gatcggctcgatcgcggccgcgaacgctcgcagcccgtggaacgcttcggccccatctcc
ggcatgatcgaaaccgcggaaaatctggctcgcgagcatggcatcagccgcgaagaggcg
gacgcctacgcggcccgcagccaccatcgcgcccgcgacgcctgggccgcgggacgattc
gatgccgaggtcataccggtatccgtgccgcaaaaaaaaggtgcgacgcttgcctttgcg
cgcgacgaaggcatacggcccgacaccagccgcgagtccctcgctgcgctgcgtccgctg
atcaagggcggcaccgtcaccgccggcaactccagccagcagaacgacgctgcggccgcc
tgcctggtggtggccgaggaaaaactctccagtctccggctggaacccatgggattcctc
atcgactgggcagccgccggttgcgatccggcgaccatgggctatggcccagtgccggcg
gtggcaaagcttttgcgcagaaccgggctgtcgctcgatcacatggatctcgtcgaactc
aacgaagccttcgcctgccaggttctcgccgtgctcaagggctggggctggaacgatccg
gaccggctcaacgtcaacggctcgggaatatccctcggtcatcccatcggcgcgaccggc
gtgcgcatcctcgccaccctgctgcacgaactggcgcgtcgcggcggacgctacggtctg
gagaccatgtgcattggcggcggccagggtcttgcggcaatattcgagcgagccggccag
gcggcgggttag

DBGET integrated database retrieval system