KEGG   Steroidobacter denitrificans: ACG33_04880Help
Entry
ACG33_04880       CDS       T04296                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf00860  Porphyrin and chlorophyll metabolism
sdf00970  Aminoacyl-tRNA biosynthesis
sdf01100  Metabolic pathways
sdf01110  Biosynthesis of secondary metabolites
sdf01120  Microbial metabolism in diverse environments
Module
sdf_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACG33_04880
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACG33_04880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sdf01007]
    ACG33_04880
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sdf03016]
    ACG33_04880
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sdf02048]
    ACG33_04880
Enzymes [BR:sdf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     ACG33_04880
Amino acid related enzymes [BR:sdf01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   ACG33_04880
Transfer RNA biogenesis [BR:sdf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ACG33_04880
 Prokaryotic type
   Other AARSs
    ACG33_04880
Prokaryotic defense system [BR:sdf02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    ACG33_04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AMN46447
UniProt: A0A127F7Q9
Position
1120719..1122119
Genome map
AA seq 466 aa AA seqDB search
MTIRTRFAPSPTGMLHIGGVRTALFSWLYARRAHGVFILRVEDTDRERSTEEATQVILDG
MRWLGLDADEGPFYQSRRMDRYREVITQFLQAGHAYRCYCTKEELEAMRAEQLAAKQKPR
YDGTCRHRNEPRAGVDPVIRFRNPSEGAVIVEDAIHGRVAFANSELDDLIIARSDGSPTY
NFCVVVDDMDMRVTHVIRGDDHLNNTPRQINMLKALGAPPPMYAHVPMILGADGAKLSKR
HGAVSVLQYREEGYLPEALLNYLVRLGWSHGDQEIFSMQEMIDLFDIEDVNKSASAFNPD
KLLWLNQQHIMRSTPEHLAVHLKPQLAALGVTVSDDAKLAAVAGAQQERAKTLKEMAQNS
VFFFREPQGYDEKAAKKNLTPDSGATLEALHAKLSGITEWTAAAAHEAVNEVASQLGVGM
GKVAQPLRVAVSGTSVSPPIDVTLEVLGREAVLSRIERALEYVRAL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccgtacccgcttcgcgcccagtcccaccggcatgctgcatattggcggcgtg
cgtactgcgctgttctcctggctgtatgcacgacgcgcacacggcgtgttcatcctgcgc
gtggaagacaccgaccgggagcgctcgaccgaagaggctacgcaggtcattctggacggc
atgcgttggctgggcctggatgccgatgaaggtcccttctatcaatcccgtcgcatggat
cggtaccgggaggtcatcacacagttcctgcaggccggtcatgcctatcgctgctattgc
acgaaggaagaactggaagcgatgcgtgccgaacaactcgctgcaaagcagaagccgcgc
tatgacggtacttgccggcatcgcaacgaaccgcgtgccggtgtcgatccagtcatccgc
tttcgcaatccaagcgagggcgcggtcatcgtcgaggatgcgatccatggtcgcgtggca
ttcgcaaattcagaactcgatgatttgatcatcgctcgttcggatggttcgccgacctat
aatttctgcgtggtcgtggacgatatggatatgcgggtaactcatgtcattcgcggcgat
gatcatctgaacaacacgccgcggcagatcaacatgctcaaggccttgggtgcgccgccg
ccgatgtatgcgcacgtgcccatgattctgggcgccgacggtgccaagctgtccaagcgt
cacggtgcggtcagcgtgttgcaataccgggaggagggttacctgccggaggcgctgctg
aattatctggtccgtctgggatggtcgcatggcgatcaggaaattttctccatgcaggaa
atgatcgatttgttcgatatcgaggatgtgaacaaatcggcttcggccttcaaccccgac
aagctgctgtggttgaaccagcaacatatcatgcgttcgacgccggagcaccttgccgtc
cacctcaagccccaactggccgcgctgggcgtaaccgtctcggacgatgccaagctcgcg
gccgtggccggggctcagcaagagcgtgccaagacgctcaaggagatggcgcagaacagc
gtcttctttttccgggagccgcagggttatgatgagaaggcagcgaaaaagaacctcacg
cccgacagcggagctacgctggaggctctgcatgcaaaactgtctgggatcactgaatgg
accgccgccgccgcgcatgaggcggtcaatgaggtggcgtcgcagctcggcgtcgggatg
gggaaagtagcgcagccgctgcgggttgccgtctccggtacgtccgtctcgccgccgatc
gacgtgaccctggaggtgctggggcgtgaagcagtgctttccaggatcgagcgggcattg
gaatacgtgcgcgcactgtaa

DBGET integrated database retrieval system