KEGG   Steroidobacter denitrificans: ACG33_05280Help
Entry
ACG33_05280       CDS       T04296                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ACG33_05280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sdf03011]
    ACG33_05280
Ribosome [BR:sdf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ACG33_05280
  Bacteria
    ACG33_05280
  Archaea
    ACG33_05280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 AAA_lid_6
Motif
Other DBs
NCBI-ProteinID: AMN46517
UniProt: A0A127F7Y6
Position
1201143..1201484
Genome map
AA seq 113 aa AA seqDB search
MQVAAKLKNARISPQKCRLVADMVRGQPVGLALNTLRFTPKKGARLVRKVLESAIANAEN
NLSADVDELKVQTITVDEAPVLKRFRARAKGRGSRIWKRNSHIIVTVGDGKSE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcgcagcgaaactcaagaacgcgcgcatttctccgcagaaatgccggctggtc
gccgacatggttcgcggtcagcctgtcggcctggcgctcaataccctgcgcttcacgccc
aagaagggcgcgcggctggtgcgcaaggttctggaatccgcgatcgccaatgccgagaac
aatctcagcgcggacgtcgatgaactcaaggtgcagacgatcacggtcgacgaggcaccg
gtactgaagcgattccgggcgcgcgcgaaggggcgtggcagccgtatctggaagcgcaac
agccacatcattgtgacggtcggcgacggcaagagcgagtaa

DBGET integrated database retrieval system