KEGG   Steroidobacter denitrificans: ACG33_06255Help
Entry
ACG33_06255       CDS       T04296                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
sdf  Steroidobacter denitrificans
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ACG33_06255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HTH_39
Motif
Other DBs
NCBI-ProteinID: AMN46703
UniProt: A0A127F8E2
Position
complement(1395222..1395596)
Genome map
AA seq 124 aa AA seqDB search
MPAHRIRIDVSTCYLDEQSKPDEDHYAFAYTITIRNEGRVAARLLTRHWLITDANGRVKE
VRGEGVLGEQPYLMPGHGFRYSSGAVLETPVGAMQGSYRMLGDDGAHFDAPIAAFTLAMP
GLLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcccacaggattcgtatcgacgtcagcacctgctacctcgacgaacaatccaag
ccggacgaggatcattacgctttcgcctatacgatcacgatccgcaacgaaggcagggtg
gcagcccgcctgctgacccgccattggctgatcaccgatgcgaacggcagggtgaaagaa
gtgcgcggagagggagtcctcggcgagcagccctatcttatgccgggccatggattccgc
tattccagcggcgccgtacttgagaccccggtgggagcgatgcagggcagctaccggatg
ctcggcgatgatggcgctcacttcgatgcgcccatcgcagccttcacgctggcgatgccc
ggcctgcttcactag

DBGET integrated database retrieval system