KEGG   Steroidobacter denitrificans: ACG33_06415Help
Entry
ACG33_06415       CDS       T04296                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf00670  One carbon pool by folate
sdf01100  Metabolic pathways
sdf01120  Microbial metabolism in diverse environments
sdf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ACG33_06415
Enzymes [BR:sdf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ACG33_06415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AMN46735
UniProt: A0A127FAW6
Position
1427353..1428273
Genome map
AA seq 306 aa AA seqDB search
MSVEYVKERIARAADGLYGRPAVSFEFFPPNNEQMEHTLWQSLQRLIPLQPRFVSVTYGA
DGSTRERTHDIVTRIQQTTSLTAAPHLTCVGASREEVLDIAHNYWEHGIRHIVALRGDPP
QGASVYTPHPGGFPYALDLVKGLKSVADFEISVAAYPETHPEASSPAFDLDYLKAKIDAG
AQRAITQFFFDPELFLRFRDRCAAAGISAAIVPGILPITRFPQMQRMAQRCGASVPDWLV
HRFDGLDEDADTRRLIAAAFAIEQVQALQRHGVEEFHFYTLNRSELTYAICHALDVRPVA
MQAVSA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcgaatatgtcaaggagcggatcgcacgggccgccgatggtctgtatggacgg
cctgcggtgtcgttcgaattcttcccgcccaacaacgagcagatggaacacacattgtgg
cagtcgttgcagcgcctgattccgctgcagccgcgtttcgtctcggtgacctacggtgcg
gacggctcgacccgcgagcgtacgcatgacatcgtcactcgcatccagcagacgacttcg
ctgacggcggcaccccacttgacctgtgttggcgcctcgcgcgaagaagttctcgatatc
gcgcacaattactgggagcacggtattcgtcatatcgtggccttgcgcggcgatccgccg
cagggagcaagcgtctatacgccgcaccccggcggttttccctacgcgcttgatctggtg
aagggactgaagtccgtagccgatttcgagatctcggtggcagcctatccggaaacgcat
ccggaagcgtccagcccggcgttcgatctggactacttgaaggcgaagatcgacgcgggt
gcgcagcgggcgatcacgcagttctttttcgatcccgagctgttcctgcgtttcagggat
cgatgcgccgccgcgggcatcagcgccgccatcgtaccgggtattctgccgatcacgcgt
ttcccgcagatgcagcgtatggcgcagcgttgcggcgccagcgtgcctgattggctcgtg
catcgattcgacgggctcgacgaggatgccgatacacgacggttgatcgccgcggcgttc
gccatcgagcaggtccaggcgctgcagcgccacggcgtagaagaattccatttctatacg
ctgaatcgcagcgaactgacttatgcgatctgtcatgccctggacgtgcgtcctgtcgcg
atgcaggccgtcagcgcctga

DBGET integrated database retrieval system