KEGG   Steroidobacter denitrificans: ACG33_07895Help
Entry
ACG33_07895       CDS       T04296                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACG33_07895
Enzymes [BR:sdf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ACG33_07895
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ACG33_07895
    1.1.1.-  
     ACG33_07895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NADH_4Fe-4S Pan_kinase 2-Hacid_dh_C Ste5_C
Motif
Other DBs
NCBI-ProteinID: AMN47019
UniProt: A0A127FBT0
Position
complement(1742453..1743508)
Genome map
AA seq 351 aa AA seqDB search
MTKMRSVTLVAPRRFEIVEVDKPVVDRDSVIVKIEGHGICGSNLHFWYGGGSANAMSCYP
MPGAGGHEFAGVVVEAGEGVGAVKVGDRVAVDFFHSTSCGRCSYCMMGWTNQCTGRPAHS
VGGFVEYLKLSERGLHLLPDSIETHAAAIAEPAAVPVSALRRVGLHGGEQVVVLGSGVVG
LAAIGAAKAMGASRVVATAKHEQQAAFARRFGADAVVRSTDSKCVDEIRAELDGLGADIV
VETVGGHAPTLDYATEVVRPRGEVVVLGLWDELVPMDSWKAVLKDVTYRFCLTYGAHGVK
TDFAYTVELMGSRKVPMQDLITHVLPLDRISEAFEIAADKSSGAVKVVLSP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagatgagatcggtgacactcgtggctcctcgaaggttcgagatcgtcgaggtg
gacaaaccagtcgtcgaccgcgattccgtgatcgtcaagatagaaggtcatggcatttgc
ggcagcaacctgcatttctggtacggcggcggatcggcgaacgcgatgtcctgttatccg
atgccaggagccggaggacacgaattcgccggcgtggtggtggaagcgggtgaaggcgtc
ggcgccgtcaaggtcggcgaccgggtggccgtcgatttcttccatagcacatcctgcggc
aggtgttcctactgcatgatgggatggaccaaccaatgcaccggccgaccggcgcattcg
gtcggtggattcgtggaatacctcaagctctccgaaagaggcttacatctcctgccggat
tccatcgagacgcatgctgcggccatcgcggaacccgccgccgttccggtcagcgcgctc
aggcgggtcgggctccatggcggagagcaggtagtggttctgggctccggcgtcgtcggg
ttggccgcgatcggggccgccaaggcgatgggtgcaagccgcgtagtagcgaccgcaaag
cacgagcagcaggccgccttcgcgaggcggtttggcgcagatgcggtcgtgcgcagcacg
gactcgaaatgcgtggatgagatcagagcggaactcgacggtctgggggctgatatcgtc
gtggagactgtgggtggccatgcgcccaccctggactatgcgaccgaagtcgtcaggcct
cggggagaggtggtcgtgctcggcttgtgggacgaactggtgcccatggattcctggaag
gccgtgctgaaggatgtgacctatcgcttttgcctgacctatggggcgcatggagtaaag
acggattttgcttacacggtcgagctcatgggctcgcggaaagttccgatgcaggatctc
attacccatgtattaccactggatcgcatcagcgaggccttcgagatcgcggcagacaag
agcagcggtgccgtcaaagtcgtcctgagcccttga

DBGET integrated database retrieval system