KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_05490Help
Entry
SDE12394_05490    CDS       T02017                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
sdg00620  Pyruvate metabolism
sdg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDE12394_05490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sdg02000]
    SDE12394_05490
Enzymes [BR:sdg01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SDE12394_05490
Transporters [BR:sdg02000]
 Other transporters
  Primary active transporters [TC:3]
   SDE12394_05490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like His_biosynth ThiD2 Sulfotransfer_4
Motif
Other DBs
NCBI-ProteinID: ADX24572
Position
complement(1059114..1060508)
Genome map
AA seq 464 aa AA seqDB search
MTKIRITETVLRDGQQSQIATRMTTEEMIPILETLDNAGYHALEMWGGATFDSCLRFLNE
DPWERLRTIRKAVKKTKLQMLLRGQNLLGYRNYADDVVRSFIQKSIENRIDIVRIFDALN
DPRNLQTAISATKEFGGHAQVAISYTTSPVHTVDYFVDLAKAYQAIGADSICIKDMAGVL
TPETGYQLVKRIKENTTIPLEVHTHATSGISEMTYLKVAEAGADIIDTAISSFSGGTSQP
ATESMAIALTDLGFDTGLDMQEVAKVAEYFNTIRDHYRETGILNPKVKDTEPKTLIYQVP
GGMLSNLLSQLTEQGLADKYEEVLAEVPKVRADLGYPPLVTPLSQMVGTQALMNIISGER
YKVVPNEIKDYVRGLYGQSPAPLAEGIKEKIIGDEAVIACRPADLIEPQLVYLRDEIAQY
ARSEEDVLSYASFPQQARDFLGRREDPFYDVPVQEVTVQLDIQD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatccgtataacggaaacagttttacgtgatggtcaacaaagtcagattgcc
acacgtatgacaaccgaggaaatgattcctattctagaaactctagataacgctggttat
catgcccttgaaatgtggggaggggcaacctttgattcctgcctacgctttttaaatgaa
gacccttgggaacgccttagaaccattcgcaaagcggtcaaaaaaaccaagttgcaaatg
ctcttacgtggacaaaatctacttgggtatcgcaattatgctgacgatgtggtcagatcc
tttattcaaaaatcaattgaaaataggattgatattgtccgtattttcgatgctttaaac
gacccacgcaaccttcaaacagcaatatcagctaccaaagaatttggtggacatgcccaa
gtggctatttcctatacaaccagcccagtgcataccgtagactacttcgtagaccttgcg
aaagcctatcaggcaattggagctgattctatctgtattaaagatatggccggagtgtta
actccagaaacaggttaccagttggtcaaacgtatcaaggagaatacaactatccctctt
gaagttcatacccatgctaccagtggtatttcagaaatgacttacttaaaagtggcagaa
gcaggagctgatattattgatacagcgatttcctctttttcagggggaaccagtcagcct
gccacagaatcaatggcgattgccttgacggatttaggctttgacacaggcttggatatg
caagaggtggccaaagttgcagaatatttcaataccattcgtgaccattaccgagagaca
gggattttaaatcccaaagtcaaagacactgagccaaaaacattgatttaccaagttcca
ggtggcatgctatcaaacctattgagccaattaaccgagcaaggcctagctgataaatac
gaagaagtcttagcagaagtacctaaagtaagggccgatcttggatatccaccacttgta
acgccattatcacaaatggttggcacacaggccttgatgaatatcatctcaggggaacgc
tacaaggtagttccaaatgaaatcaaagactatgttcgagggctatacggtcaatcacca
gcgccactagcagaaggtatcaaagagaaaatcattggtgacgaagcagtcattgcttgc
agaccagctgacttaattgaaccacaactggtctatctacgtgacgagattgctcaatac
gctcgttcagaagaagacgtgctaagctatgcaagcttcccacagcaagccagagatttc
ttgggacgccgtgaagatcctttctatgatgttccggttcaagaagttactgtacaactg
gacattcaagactaa

DBGET integrated database retrieval system