KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_06450Help
Entry
SDE12394_06450    CDS       T02017                                 

Definition
(GenBank) haloacid dehalogenase-like hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
sdg00627  Aminobenzoate degradation
sdg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SDE12394_06450
Enzymes [BR:sdg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SDE12394_06450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ADX24752
Position
complement(1244557..1245204)
Genome map
AA seq 215 aa AA seqDB search
MVTNNTTRTPEMVQDMLSKQFNVETGIETIYTATMATVDYMNDMNRGKTAYVIGETGLKS
AIAAAGYVEELENPAYVVVGLDSQVTYDMLATATLAIQKGALFIGTNPDLNIPTERGLMP
GAGALNALLEAATRVKPIFIGKPNAIIMNKSLEVLGVKRSEAVMVGDNYLTDIMAGIQND
IATILVTTGFTRPEEVPTLPVQPDHVLSSLDEWEL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttggtgactaataatacaacacgcacacctgaaatggtccaagacatgttgtctaaacag
tttaatgttgagacaggcattgagactatctacacagctactatggcgaccgtcgattac
atgaatgacatgaaccgtggtaaaacagcttacgttattggagaaacaggtctcaaatca
gctattgcagctgcaggctacgtagaagaacttgagaatcccgcttacgtagtggttggg
ttagacagtcaggtgacctatgacatgctagctaccgctaccttagccattcaaaaggga
gccctctttattgggacaaatcctgatttaaacattccaaccgaacgtggtttgatgcca
ggagcaggtgcattgaatgccttactagaagctgccacacgtgtgaagcctatttttatc
ggaaaacccaatgctatcattatgaataaatcactagaagtcctaggagtcaaacgttcc
gaagcagtgatggttggggataattacttgactgatatcatggcaggcattcaaaatgat
attgcaaccattctggtgacaacaggttttacgagacctgaagaagtaccaaccttacca
gtgcagccagatcatgtcctatctagtcttgatgagtgggaattgtga

DBGET integrated database retrieval system