KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_06530Help
Entry
SDE12394_06530    CDS       T02017                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
sdg00010  Glycolysis / Gluconeogenesis
sdg00020  Citrate cycle (TCA cycle)
sdg00620  Pyruvate metabolism
sdg01100  Metabolic pathways
sdg01110  Biosynthesis of secondary metabolites
sdg01120  Microbial metabolism in diverse environments
sdg01130  Biosynthesis of antibiotics
sdg01200  Carbon metabolism
Module
sdg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_06530
   00020 Citrate cycle (TCA cycle)
    SDE12394_06530
   00620 Pyruvate metabolism
    SDE12394_06530
Enzymes [BR:sdg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SDE12394_06530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B
Motif
Other DBs
NCBI-ProteinID: ADX24766
Position
complement(1258410..1259819)
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDVLLEIMSDKTNMELEAEDSGVLLKIV
RPAGDTVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADAGPTVAPKEDVASPAPQV
AATAIPQGNGGKVRATPAARKVAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVELPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLINPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINNANDIELHRFVNLGIAVGLDDGLIVPVIHGADKMSLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctcggcgttgacatgcaagagggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatgtccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgttctattgaaaattgtt
cgtccagctggtgatactgtacctgtaactgaagttatcggttacattggtgcagaaggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagatgcaggaccaacagtagctccaaaagaagatgtggccagtccagctcctcaggta
gcagcgacagctattccgcaaggaaatggtggaaaagttcgtgctactccagctgcacgt
aaggttgcagcagaaatgggcattgaccttggtcaagttccaggaacaggaccaaaaggg
cgtgtccataaagaagatgttgagaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaatcgctgctgataaaggtatcgacttggcgactgtttcaggtactggcttt
aacggtaaggtcatgaaagaagacatcatggctattcttgaagctgctaaaccagctgaa
gcaaaagcaccagcagctaaagaagaaaaagttgttgagcttccagagggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gcgcctacctttacgcttaactacgatattgatatgacagaaatgatcgcccttcgtaag
aagttaattaacccaatcatggctaaaacaggccttaaagtcagcttcacagacttgatt
ggtatggcagtggttaaaacgttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaataacgctaatgatattgaattgcaccgctttgtgaacctgggtattgccgtaggt
cttgatgatggtcttattgttccagttatccatggtgcagataagatgagcttgtcagat
ttcgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaagcagct
gaaatgtctggatcaaccttctcaatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgttgcccgtccaattatggcgatgtgcttaaccatc
gaccatcgcttggtagacggtatgaacggtgcaaaattcatggttgacctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system