KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_08505Help
Entry
SDE12394_08505    CDS       T02017                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
sdg00071  Fatty acid degradation
sdg00072  Synthesis and degradation of ketone bodies
sdg00280  Valine, leucine and isoleucine degradation
sdg00310  Lysine degradation
sdg00362  Benzoate degradation
sdg00380  Tryptophan metabolism
sdg00620  Pyruvate metabolism
sdg00630  Glyoxylate and dicarboxylate metabolism
sdg00640  Propanoate metabolism
sdg00650  Butanoate metabolism
sdg00900  Terpenoid backbone biosynthesis
sdg01100  Metabolic pathways
sdg01110  Biosynthesis of secondary metabolites
sdg01120  Microbial metabolism in diverse environments
sdg01130  Biosynthesis of antibiotics
sdg01200  Carbon metabolism
sdg01212  Fatty acid metabolism
sdg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sdg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDE12394_08505
   00630 Glyoxylate and dicarboxylate metabolism
    SDE12394_08505
   00640 Propanoate metabolism
    SDE12394_08505
   00650 Butanoate metabolism
    SDE12394_08505
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SDE12394_08505
   00072 Synthesis and degradation of ketone bodies
    SDE12394_08505
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SDE12394_08505
   00310 Lysine degradation
    SDE12394_08505
   00380 Tryptophan metabolism
    SDE12394_08505
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SDE12394_08505
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SDE12394_08505
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SDE12394_08505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdg04147]
    SDE12394_08505
Enzymes [BR:sdg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SDE12394_08505
Exosome [BR:sdg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SDE12394_08505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADX25141
Position
1673092..1674279
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLATQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAARALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLNLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagatatggtttgcggttctggacttaaagcaatccaattagctacgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtggaaaacatgtcacag
gcagcctatgtgtcaactcagcaccgctttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggcttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctagggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagatcctttaattgttacgacggatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgatttgaacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system