KEGG   Spiroplasma diminutum: SDIMI_v3c07360Help
Entry
SDIMI_v3c07360    CDS       T02741                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sdi  Spiroplasma diminutum
Pathway
sdi00430  Taurine and hypotaurine metabolism
sdi00620  Pyruvate metabolism
sdi00640  Propanoate metabolism
sdi00680  Methane metabolism
sdi01100  Metabolic pathways
sdi01120  Microbial metabolism in diverse environments
sdi01200  Carbon metabolism
Module
sdi_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDIMI_v3c07360 (ackA)
   00640 Propanoate metabolism
    SDIMI_v3c07360 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    SDIMI_v3c07360 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SDIMI_v3c07360 (ackA)
Enzymes [BR:sdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SDIMI_v3c07360 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK Peptidase_M10_C LacAB_rpiB
Motif
Other DBs
NCBI-GeneID: 16854586
NCBI-ProteinID: AGR42440
UniProt: S5MKD6
Position
complement(816530..817720)
Genome map
AA seq 396 aa AA seqDB search
MILVVNAGSSSIKFKLFDISNSSNPISKVEGLAERISVDGRLTIEIEGEKHEFNNQMNDH
LDAVQLILNKFTELKVIEKPEDIKGIGFRIVHGGDKVVKPVEITDEIKKTIEENIRLAPL
HNPGALTSINAFEKSLPNAKLVGCFDTSYHQTMPEVNYMYTVPYEWYSKYQVRKYGFHGI
SYEYIAFKAQEIFNKKQENLNLIVCHLGNGASVCAIKNGKSFNTTMGLTPLAGLMMGTRS
GDIDPSIIQYISKETGKDLFEITDILNKQSGLQGISEISSDMRDVIEQSTKGNDKASLAV
ELYTQIVADFIVKFANQINDKIDGIIFTAGIGENAALIREKITQKSNLLGLVIDSQLNEE
KYSDYLNISSKESKISILKVRTNEELMICNETLKFL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtagtaaatgccggaagtagttcaataaaatttaaattatttgatatatca
aattcttcaaatccaatttcaaaagttgaaggtttagcagaaagaatttctgtagatgga
agattaacaattgaaatcgaaggagaaaaacatgagtttaataatcaaatgaatgaccat
ttagatgctgttcaattaattctaaataaatttacagaattaaaagtaattgaaaaacca
gaagatattaaaggtattggtttcagaatagtccatggtggagataaagtagttaaacca
gttgaaataactgatgaaattaaaaaaactattgaagaaaatataagattagcaccattg
cataatccaggagctttaacttcaataaatgcatttgaaaaaagtttaccaaatgctaaa
ttagtagggtgttttgatacttcatatcatcaaactatgccagaagttaattatatgtac
actgttccgtatgaatgatattcaaaatatcaagtaagaaaatatggtttccatggtatt
agttatgaatatattgcatttaaagcacaagaaatttttaataaaaaacaagagaattta
aatcttattgtttgtcatttaggaaatggtgcaagtgtttgtgcaattaaaaatggaaaa
tcatttaatacaacaatgggattaactccacttgctggtttaatgatgggtacaagaagt
ggagacattgacccttcaataattcaatatatttcaaaagaaactggaaaagacttattt
gaaataacagatatattaaataaacaatctgggttacaaggaataagtgaaattagtagt
gatatgagagatgtcattgaacaatctacaaaaggaaatgacaaagcttcattagcagta
gaactttatacacaaatagttgcagattttatagttaaatttgcaaatcagattaatgat
aaaattgatggaattattttcacagcaggaattggagaaaatgcagctttaattagagaa
aaaattactcaaaaatcaaatttattaggattagtaattgactctcaattaaatgaggaa
aaatattcagattatttaaatatttcttcaaaagaatcaaagatatctatattaaaagta
agaactaatgaggaattaatgatctgtaatgaaacacttaaatttttataa

DBGET integrated database retrieval system