KEGG   Sulfurospirillum deleyianum: Sdel_0044Help
Entry
Sdel_0044         CDS       T01126                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00040  Pentose and glucuronate interconversions
sdl00052  Galactose metabolism
sdl00500  Starch and sucrose metabolism
sdl00520  Amino sugar and nucleotide sugar metabolism
sdl01100  Metabolic pathways
sdl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sdel_0044
   00052 Galactose metabolism
    Sdel_0044
   00500 Starch and sucrose metabolism
    Sdel_0044
   00520 Amino sugar and nucleotide sugar metabolism
    Sdel_0044
Enzymes [BR:sdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sdel_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 HTH_17
Motif
Other DBs
NCBI-ProteinID: ACZ11082
UniProt: D1B0T8
Position
41826..42695
Genome map
AA seq 289 aa AA seqDB search
MSSISKYNKINNLKSVKKCLFPAAGYGTRFLPATKAMPKEMLPVLTKPLIQYGVEEAVSA
GIDTMAIVTGRGKRAIEDHFDVSYELEHQIRGTSKESYLTEIRNLIDNCTFSYTRQIEMK
GLGHAILTGKTLIGDEPFAVILADDLCDNQDEDPVLKQMVEVYEKYRCCVVAIEEVPKEE
TNKYGVIDGRIVDGNESVLRVSNMVEKPDPKDAPTNLAIIGRYILTPDIFEVIENTKPGK
GGEIQITDALLELARQGKVIAYKFNGRRFDCGSIEGFVEATNYFYNKAN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaagtatctcgaaatacaataaaatcaataatttaaaatccgtgaaaaagtgtctt
ttcccagccgcagggtatggaacacgttttcttcctgcaaccaaagcgatgcccaaagag
atgttacctgttttaactaaacctcttattcaatacggtgtggaagaagccgtaagtgcg
ggtattgatacgatggcgattgttacgggccgtggtaaaagagcgattgaagaccatttt
gacgtaagctatgagcttgagcatcagattcgaggaacctcaaaagagagttacttgacc
gaaattcgaaatctcattgataattgtacgtttagttataccagacagattgagatgaag
gggttgggacacgctattttaacgggtaaaacgttgattggtgatgagccatttgcggtt
attttggccgatgacctttgtgacaatcaagatgaagatcctgtgcttaaacagatggtt
gaagtgtatgaaaaataccgttgttgtgtcgttgccattgaagaagtacccaaagaagag
accaataaatacggtgtgattgatggcagaatcgtcgatggaaatgagtcggttttacgt
gtttctaacatggttgaaaaacctgatcctaaagatgccccaacaaatctagcgattatt
ggacgttatattttaacacctgatatttttgaagtcattgaaaatacaaagccaggcaaa
ggcggagaaattcaaattaccgatgctcttttagaactcgctcgacaaggcaaagtgatc
gcctataaattcaatggaagacgttttgattgtggttctattgaaggatttgtggaagcg
acaaactacttttacaacaaagcaaactaa

DBGET integrated database retrieval system