KEGG   Sulfurospirillum deleyianum: Sdel_1306Help
Entry
Sdel_1306         CDS       T01126                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sdl01100  Metabolic pathways
sdl01110  Biosynthesis of secondary metabolites
sdl01130  Biosynthesis of antibiotics
sdl01230  Biosynthesis of amino acids
Module
sdl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sdel_1306
Enzymes [BR:sdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sdel_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE
Motif
Other DBs
NCBI-ProteinID: ACZ12326
UniProt: D1B2K6
Position
complement(1322469..1323257)
Genome map
AA seq 262 aa AA seqDB search
MILDEIIKRTREDLEKKKKEYTMDWLGRSLAFNPFMPRDVKPYLKATPQNPYRIIAEVKK
ASPSKGIIKEDFDPLMIAKAYELGGADAISVLTEPHYFKGNLEYLTQIRRYVPTPLLRKD
FIIDEYQILEALVYGADFILLIAKALSKTELKHLLEYALRLGLEVLVEIHDKEDLVKAMY
AGANIIGINHRNLETFEMDMSLTEKLMPLIPQNKIIVAESGLNDKETIKHLSQVGADAFL
IGEYFMREDDIEASLRAIKKVD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgagattattaagcgtacacgtgaggatttagagaaaaagaaaaaagag
tacacgatggattggttgggaagaagccttgccttcaacccttttatgcctcgtgatgta
aagccctacctgaaagcgaccccacaaaacccttatcgcattattgctgaagtcaaaaag
gcaagtccaagtaagggaattattaaagaggattttgaccctttgatgattgctaaggcg
tatgaacttggaggcgctgatgctatctctgtactcacggagccacactattttaaaggc
aacttagaatacctcactcaaattcgccgttatgttccaacccctttgttgcgtaaagat
tttattattgatgagtatcaaatcttagaagcgcttgtatatggggctgattttatttta
ttgattgcaaaagcgctgagtaaaactgaacttaagcatttattggagtatgcattacga
cttggactagaagttttagtcgaaatacatgacaaagaagatttagtcaaagcgatgtat
gcgggagctaatattatcgggataaaccatcgaaatttagagacgtttgagatggatatg
agtttaacggaaaagctgatgcccctgattcctcaaaataaaattattgtcgcagagagt
ggcttgaatgataaagagactattaagcatctaagtcaggtcggtgcagatgcgttttta
attggagagtattttatgcgagaagatgacatagaagcttctcttcgtgcgataaaaaag
gtagattga

DBGET integrated database retrieval system