KEGG   Sulfurospirillum deleyianum: Sdel_1897Help
Entry
Sdel_1897         CDS       T01126                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sdl  Sulfurospirillum deleyianum
Brite
Enzymes [BR:sdl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sdel_1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACZ12912
UniProt: D1B492
Position
complement(1929030..1929728)
Genome map
AA seq 232 aa AA seqDB search
MFQKSLLRKRWMALVFSWLFVPALMAADAFSLAPLPYGYDALEPVIDKETMQIHHGKHHQ
AYVSNLNAQVATYPELKGMSVEQIMASISKYNAAVRNNGGGHYNHALFWKLMAPVGKGGT
PSASLSKAIERDFGSLEKMKEAFEKAGATRFGSGWAWVIVTADKKLAVTSTPNQDNPLMD
VTEAKGMPILAADVWEHAYYLKYQNKRADYLKNWWSVVNWNEVNARFDAAMK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaaatctcttctacgtaagcgttggatggcactggttttttcatggcttttt
gttcctgcattgatggcagcagatgcgtttagcttagcgcctttaccctatggatatgat
gccttagagcccgtgattgataaagagaccatgcagatccatcatggtaaacatcatcaa
gcgtatgtttcaaatcttaatgcgcaagtcgcaacgtatcctgaattgaaagggatgagt
gtggagcaaataatggcatcaatttccaaatacaatgcagcggtgagaaataacggtggt
ggacactataaccatgcacttttttggaaactcatggcgcctgtgggaaaaggcggtacg
ccatcagcttcactttctaaagcgattgagcgtgattttggaagtttagagaagatgaaa
gaggcgtttgaaaaagcaggagcgactcgttttggctcaggttgggcgtgggttatcgtt
accgcagataaaaaattagcagtgacatcaacacccaatcaggacaatcctctcatggac
gtcacagaagcgaagggaatgccaatcttagcggcagatgtctgggaacatgcgtattat
cttaagtatcaaaataaacgagcagattatttgaaaaattggtggagtgtggtgaattgg
aatgaggtcaatgcacgttttgatgcggcaatgaagtag

DBGET integrated database retrieval system