KEGG   Sulfurospirillum deleyianum: Sdel_2156Help
Entry
Sdel_2156         CDS       T01126                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00790  Folate biosynthesis
sdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sdel_2156
Enzymes [BR:sdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sdel_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638 OmpH
Motif
Other DBs
NCBI-ProteinID: ACZ13168
UniProt: D1B4Z8
Position
complement(2163805..2164386)
Genome map
AA seq 193 aa AA seqDB search
MIMERKEEFENAVKTMLEIIGENTQREGLLKTPSRVFKAYEYMTQGYHQSPTEVLNEALF
ESDNNQMVLIKDIEFYSMCEHHLLPIIGRAHVAYIPNGKVVGLSKIPRMVDIFARRLQIQ
EQLTEQIAKAIDDVIAPKGVGVVIQARHMCMEMRGVEKTHSNTTTSALRGLFLKADTRKE
FFDIINAPQANRY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcatggaacgaaaagaagaatttgaaaatgctgtaaaaacgatgttagaaattatt
ggtgaaaacacacagcgtgaaggtcttttaaaaacgccttctcgagtctttaaggcatat
gaatacatgacacaagggtatcatcaaagccctactgaagtcttgaatgaagcactgttt
gagagcgataataatcaaatggttttaattaaagatattgaattttattcgatgtgtgag
caccatcttttgccgattattggaagagcgcatgtggcctatattcctaatgggaaagtg
gtagggctttctaaaattcctcgtatggtggatatctttgcacgtcgtttgcaaattcaa
gaacaactgactgaacagattgccaaagcgattgatgatgtcattgctcctaaaggagtg
ggggttgttattcaggcgcgtcatatgtgtatggagatgcgaggtgtggaaaaaacccac
tccaatacaaccacatcagcgcttcgagggctctttttaaaagcagataccagaaaagag
ttttttgacattattaacgcaccacaggctaatcgttactaa

DBGET integrated database retrieval system