KEGG   Shewanella denitrificans: Sden_2406
Entry
Sden_2406         CDS       T00344                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00620  Pyruvate metabolism
sdn00640  Propanoate metabolism
sdn00650  Butanoate metabolism
sdn01100  Metabolic pathways
sdn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sden_2406
   00640 Propanoate metabolism
    Sden_2406
   00650 Butanoate metabolism
    Sden_2406
Enzymes [BR:sdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Sden_2406
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABE55686
UniProt: Q12LJ0
Position
2863542..2865824
AA seq 760 aa
MTDNTTVFAKAWEGFSAGNWKTQVNVRDFIQQNYTPYEGNDEFLADATEATTQLWDQVME
GIKLENSTHAPVDFDTDKVSTITSHAAGYINQDLETIVGLQTEAPLKRAMLPNGGIRMVE
SSCKAYGRELNTDINYIYSELRKTHNQGVFDVYTPEIMACRKSGVLTGLPDAYGRGRIIG
DYRRIALYGIDYLMQDKLGQFTSLQAQFEAGEDLSAVIQLREEISEQYRALAQMKQMAST
YGFDISVPAVTAQQAIQWTYFGYLAAVKSQNGAAMSLGRTSSFLDIFIERDLKNGIITEQ
QAQEMLDHFVMKLRMVRFLRTPEYDELFSGDPIWATESIGGMGLDGRTLVTKSSFRFLHS
LYNMGPSPEPNITVLWSKKLPQAFKNYCAKVSIDTSSIQYENDDLMRPDFDSDDYAIACC
VSPMIVGKHMQFFGARANLAKTMLYAINGGVDEKLNIQVAPKTAPISTDVLDFDDVMTRL
DNLMEWLATQYVTALNSIHYMHDKYAYEAALMALHDRDVRRTMACGIAGLSIAADSLSAI
KYAQVKPIRDENGIAIDFDIQGDYPKFGNNDARVDDIACDLVERFMAKIRDKKMYRNAIP
TQSILTITSNVVYGKKTGNTPDGRRSGAPFAPGANPMHGRDENGAIASLTSVAKLPFAHA
QDGISYTFSIVPNALGKDDAGRSVNLAALMDGYFSSGPSREGGQHLNVNVMNREMLVDAI
AHPDKYPQLTIRVSGYAVRFNSLTTEQQQDVVTRTFTQGL
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgacagacaacaccacagtattcgccaaggcatgggaaggttttagtgccggcaattgg
aagactcaagtcaatgtccgcgacttcatacagcaaaactacactccctatgaaggcaat
gatgaatttttagccgatgctaccgaggccaccacccagttatgggaccaggtcatggaa
ggcattaagcttgaaaattcaacccatgctccggtggattttgataccgataaggtatcc
accattacctcccatgctgcgggctacattaatcaagatttagagaccatagtcggcttg
caaaccgaagcgccacttaaacgtgccatgctacctaatggcggcattcgcatggttgaa
agctcatgcaaagcctatggccgtgagctcaatactgatatcaactatatctattccgaa
cttcgcaaaacccacaatcagggagtattcgatgtctacacccctgaaatcatggcctgt
cggaaatccggggtattaaccggtctacccgatgcttatggccgtggtcgtattattggt
gattaccgccgtatcgcgctttacggtatcgactacttgatgcaagacaagctcggccaa
ttcacctccttacaagcacagtttgaagcaggtgaagacttatctgcagtgattcaatta
agggaagaaatctctgagcagtaccgtgcgcttgcacaaatgaagcagatggcaagcact
tacggtttcgatatttcagtgccagcggtaaccgcgcaacaggccattcagtggacctat
ttcggttatttagctgcggttaagagccaaaatggtgctgccatgtcattagggcgcacc
tcaagtttcctcgatattttcatcgagcgcgatcttaaaaacggcatcattacagagcaa
caagctcaagaaatgcttgatcatttcgtgatgaaactgcgtatggtgcgcttcttacgc
acccctgaatacgatgagctattctctggcgatccaatttgggcaaccgaatcaatcggc
ggcatgggacttgatggccgaacccttgtgaccaaatcaagctttcgtttcctgcatagc
ttgtacaacatgggcccaagccctgagccaaacatcaccgtactttggtcgaaaaaactg
ccacaggctttcaaaaactattgcgctaaggtgtcgattgacactagctcaattcaatat
gaaaacgatgatctcatgcgtcctgatttcgactcagatgattatgctatcgcctgctgt
gtaagccctatgatagtgggtaaacatatgcaatttttcggcgcgcgagcaaacttagcc
aagaccatgctatatgccattaacggcggcgtggatgaaaaacttaacattcaagtggcg
ccaaaaacggcacctatctcaacagatgtgctcgatttcgatgatgtgatgacccgctta
gacaacttaatggagtggttagccactcaatatgtcacagcactgaactcaatccactac
atgcacgataaatacgcttatgaagcggcattaatggcacttcacgacagggatgtgcgc
cgcaccatggcatgcggtatcgcaggtttgtccatcgcagctgactccttatcggctata
aaatatgcccaagtgaagcccattcgtgatgagaacggcatcgccatcgattttgatatt
caaggggattatccaaaatttggtaataacgatgccagagtcgatgacatagcgtgtgac
ttagttgaacgttttatggcgaaaattcgtgataagaaaatgtatcgcaatgccatacca
acccagtcaattttaaccatcacctcaaacgtcgtttatggtaaaaaaaccggcaatacg
ccagatggtcgccgctcaggcgcgccttttgccccaggggcgaaccctatgcatggccga
gatgagaatggagccattgcctcactaacatcggttgcaaaactgccttttgctcacgct
caagatggtatttcttataccttctcaatcgtacccaatgccttaggaaaagatgatgct
ggccgcagtgtcaacttagccgccttgatggatggctactttagcagtggccccagtcgt
gaaggtgggcaacacttaaacgtcaatgtgatgaaccgagaaatgctagtcgatgctatt
gctcatcctgacaagtaccctcagcttaccattcgcgtgtctggctatgcggtgaggttt
aattcattaaccacagagcagcaacaagatgtagtcactcgaaccttcacccaaggcttg
tag

DBGET integrated database retrieval system