KEGG   Shewanella denitrificans: Sden_0589Help
Entry
Sden_0589         CDS       T00344                                 

Definition
(GenBank) ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00998  Biosynthesis of secondary metabolites - other antibiotics
sdn00999  Biosynthesis of secondary metabolites - unclassified
sdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    Sden_0589
   00999 Biosynthesis of secondary metabolites - unclassified
    Sden_0589
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     Sden_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABE53879
UniProt: Q12RP7
Position
complement(672199..673212)
Genome map
AA seq 337 aa AA seqDB search
MNITTELRYLSQSDIRLLGGDHSHAFMSAIEEGLRLHAKRQFVQPLKPYLRWPDAPHIAD
RIIAMPCYLGGDNPIAGIKWIGSRQHNPTKHQLPRASAVIILNDAETNYPVAILEASLIS
AMRTAAITGIATKYLAKENFKEVSIIGCGPIAQMQVQTLLEQYPQIMIVNLYDLNPAAAD
MLISQFATRFPNVHFTIQASAEAAVKCAEVLVTCTVSDAPYIPFSWLQPGCFVSNISIMD
IEKDVFLKADKVIVDDWDQSNREKKVINQLVEEGLFSREQLHAELGDILTGEVGGRDNDD
EIILLNPMGMAIDDIVCARWFYQAALAKDIGTRLPLF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaccactgaactgcgttacctaagtcaatccgatattcgactgcttggcggc
gatcatagccatgcatttatgagcgccattgaagagggattgcgtttacacgcgaagcga
caatttgtacaaccgctcaaaccttacttacgctggccagatgcgccacacatagctgac
cgcattattgccatgccttgctatcttgggggcgataatcccatcgcgggcattaaatgg
attggctcacgtcaacataatccaactaaacaccaattaccgcgcgccagtgcagtgatc
atcttaaatgatgctgaaactaactacccagtggcgattcttgaagcgagtttaatcagc
gccatgcgcaccgcggcgatcacgggtattgcgactaaatatttagctaaagaaaacttt
aaagaagtcagcatcatcggctgcggccccattgcgcaaatgcaagtgcaaacgctgcta
gaacaatatccgcagataatgatagtgaacttgtacgatctcaacccagccgccgctgat
atgttgatcagccaatttgctacgcgcttccctaatgttcactttaccattcaagccagt
gctgaagccgcggtcaaatgtgccgaagtgctggtcacctgcacggtatcggatgcacca
tatatcccgttctcctggctacaaccaggttgtttcgtttctaacatttccattatggat
atcgagaaggatgtgttcttaaaagccgacaaagtcattgtcgatgattgggaccaatct
aatcgcgaaaagaaagtcatcaatcaattggttgaagaaggcttatttagccgtgagcaa
ctccacgccgaacttggcgacattctcacaggtgaagttggcggacgtgataatgacgat
gagatcattctgctgaaccctatgggaatggcgattgatgatattgtctgtgctcgctgg
ttctatcaagccgcgctagccaaagacattggtactcgcttaccactgttttaa

DBGET integrated database retrieval system