KEGG   Shewanella denitrificans: Sden_0691Help
Entry
Sden_0691         CDS       T00344                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sdn  Shewanella denitrificans
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Sden_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABE53981
UniProt: Q12RE5
Position
complement(799566..800834)
Genome map
AA seq 422 aa AA seqDB search
MVDVLVANGPVLIALAAAFGFLMAWGIGANDVANAMGTSVGSNAITIKQAIIIAMIFEFA
GAYLAGGEVTSTIRSGIIDSNYFTDAPQLLVYGMISALLAAGIWLVVASALGWPVSTTHS
IVGAIVGFAAVGVNADSVAWGKVGGIVGSWVITPAISGFIAYIIFQSVQKLIFNTDDPLK
NAKRYVPFYMAFAGFIMSLVTITKGLKHVGLHFSNVEAYGLAFAVAVIVGIFGSIAISRL
KMSEKADRQTTFANVEKVFAILMIVTACSMAFAHGSNDVANAIGPLAAVVSVVESGGVIA
SESTLVWWILPLGAVGIVLGLAIFGTRVMQTIGKNITHLTPSRGFAAELAAASTVVIASG
TGLPISTTQTLVGAVLGVGMARGIAAINIGVVRNIVVSWVVTLPAGAGLSIVFFYIIKGV
FE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgtattagtcgccaacggccctgtgcttattgcacttgctgcagcgtttgga
tttttaatggcatggggtattggtgcaaacgatgttgccaacgccatgggaacctcagta
ggttcaaatgctattacgataaaacaagccatcatcatagcgatgatttttgaatttgct
ggtgcgtatcttgcgggtggtgaagtcaccagcacaattcgcagtggtatcatagattca
aactactttaccgatgcaccgcaactgctggtttacggtatgatttcagccctgctggct
gcgggtatttggttagtagtggcgtcggcattaggctggccagtatcgaccactcactct
attgtgggtgccattgtgggctttgcggcagtaggcgtaaatgccgattctgtagcttgg
gggaaagtaggtggtatcgtaggttcttgggttatcaccccagccatctcaggtttcatc
gcctatattatcttccagagtgtgcagaagcttattttcaataccgatgatccattgaaa
aatgccaaacgctatgtgcctttctacatggccttcgcaggtttcatcatgtctctggtg
actatcactaagggccttaagcacgttggtttgcatttctctaatgttgaagcttacggt
ctagcgtttgctgtggctgtgattgtgggtattttcggcagcattgctatttctcgcctt
aaaatgagtgaaaaagctgaccgtcaaaccaccttcgctaatgttgagaaagtcttcgct
atcctgatgatagtgacagcctgctccatggcatttgctcacggttcaaacgacgttgct
aacgccattggtccattagccgcggtagtttctgtggtagaaagtggcggtgttattgct
tctgaatcgacacttgtgtggtggattttacccttaggtgctgtgggtatcgtattaggc
cttgccatctttggtactcgcgtaatgcaaaccataggtaagaacattactcacttaacc
ccaagtcgcggtttcgccgcagaacttgccgcagcgtcaacggttgtgattgcatcaggc
acaggtcttcctatctctaccacccaaaccttagtgggtgctgtgttaggtgtgggcatg
gctcgcggcattgcagccattaacataggtgttgtgcgtaacatcgttgtgtcatgggtt
gtaaccttacctgcgggtgcgggtttatccatagtgttcttctacatcatcaaaggtgta
ttcgaataa

DBGET integrated database retrieval system