KEGG   Shewanella denitrificans: Sden_1246Help
Entry
Sden_1246         CDS       T00344                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00630  Glyoxylate and dicarboxylate metabolism
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01120  Microbial metabolism in diverse environments
sdn01200  Carbon metabolism
Module
sdn_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sden_1246
Enzymes [BR:sdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sden_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABE54532
UniProt: Q12PU4
Position
1456275..1457600
Genome map
AA seq 441 aa AA seqDB search
MSKVEAGLTRQQQIDAIKKDWAENPRWKHVKRPFTAEEVVALRGSIVPENTIAKRGAAKL
WELVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYP
ANSVPAVVSRINNSFRRADQIQWGKEINPGDKNYTDYFLPIVADAEAGFGGVLNAFELMK
SMIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVDTLVIART
DANAADLMTSDCDAYDRDFVTGERTSEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKP
CLEEAKKFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIAKFQQELSNMGYKYQFITLA
GIHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAEKGYTFVSHQQEVGTGYFDQVTT
CIQGGKSSVTALTGSTEEEQF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaggtagaagcagggttaactcgtcagcagcagatcgatgcgattaaaaaagat
tgggctgagaatccacgttggaagcatgtgaagcgtccatttacggctgaagaagtggtt
gcactacgtggatctatcgtgccagaaaacaccatagctaaacgtggcgcggctaaatta
tgggagctggtgaatggcggagctaaaaaaggctatgtgaactcactaggtgcattgact
ggcggccaagccgtgcagcaagccaaagccggtatcgaagcgatttacctttcaggttgg
caggttgccgctgacgctaacttagcgggcaccatgtatccagaccaatctttgtatcct
gcaaactcagttccagccgtggtgagccgtattaacaactcattccgccgtgctgaccaa
attcaatggggcaaagaaattaatcctggtgataaaaattataccgactacttcctacca
atcgttgccgatgcagaagcgggttttggcggcgtactcaatgccttcgaactgatgaag
tctatgatcgatgcgggcgctgctggggttcactttgaagaccaattagcatcagtgaag
aaatgtggccacatgggcggcaaggtactagtaccgactcaagaagcggtgcaaaagcta
gtagcggcgcgtctagcggccgatgtaagcggcgttgatacgctagttatcgctcgtacc
gatgctaatgctgctgatttgatgacttcagattgtgatgcatatgaccgtgactttgtt
acaggcgagcgtaccagtgaaggtttctaccgcgttaaagcggggcttgaccaagcgatt
tctcgcggtcttgcctatgcgccatacgcagatttaatctggtgtgaaaccgctaagcct
tgccttgaagaagcgaagaaatttgctgaagcgattcacgcacagtacccagatcaattg
ctggcttataactgttcaccttcgtttaactggaagaagaacttggatgacgcaacaatt
gcaaaattccaacaagagctatcaaacatgggttacaagtaccaattcatcaccttagct
ggcattcataacatgtggtacaacatgttcgatttagcctatgactatgctcgcggtgaa
ggcatgaagcactatgttgagaaagttcaggaagttgaatttgctgctgcagagaaaggt
tatacctttgtgtctcaccagcaagaagtgggcacaggctacttcgaccaagtgacgacc
tgtatccaaggtggtaagtcttcagtaacggcactaacgggttcaactgaagaagaacag
ttttaa

DBGET integrated database retrieval system