KEGG   Shewanella denitrificans: Sden_1943Help
Entry
Sden_1943         CDS       T00344                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00071  Fatty acid degradation
sdn00072  Synthesis and degradation of ketone bodies
sdn00280  Valine, leucine and isoleucine degradation
sdn00310  Lysine degradation
sdn00362  Benzoate degradation
sdn00380  Tryptophan metabolism
sdn00620  Pyruvate metabolism
sdn00630  Glyoxylate and dicarboxylate metabolism
sdn00640  Propanoate metabolism
sdn00650  Butanoate metabolism
sdn00900  Terpenoid backbone biosynthesis
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01120  Microbial metabolism in diverse environments
sdn01130  Biosynthesis of antibiotics
sdn01200  Carbon metabolism
sdn01212  Fatty acid metabolism
sdn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sden_1943
   00630 Glyoxylate and dicarboxylate metabolism
    Sden_1943
   00640 Propanoate metabolism
    Sden_1943
   00650 Butanoate metabolism
    Sden_1943
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sden_1943
   00072 Synthesis and degradation of ketone bodies
    Sden_1943
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sden_1943
   00310 Lysine degradation
    Sden_1943
   00380 Tryptophan metabolism
    Sden_1943
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sden_1943
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sden_1943
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sden_1943
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdn04147]
    Sden_1943
Enzymes [BR:sdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sden_1943
Exosome [BR:sdn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sden_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt PTS_IIB
Motif
Other DBs
NCBI-ProteinID: ABE55226
UniProt: Q12MV0
Position
complement(2300521..2301711)
Genome map
AA seq 396 aa AA seqDB search
MSSVQSNQDIVIVAAKRTPMGGFQGALSGVASPVLAATAIKDLLEQTGIAASAVNEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSSEVVIAGG
MESMSQAPYLLDKARSGMRMGHGKVMDHMFLDGLEDAYTGGAMGTFAQKTADDFNLSREQ
MDGFALSSLEKANAAINSGAFKAEITPVTVSDRRGDITIDTDEQPGNARPEKIPTLRPAF
TKDGTITAANSSSISDGAAALMLMTREKASSLGLEVMATIKGHSTHAQEPSLFTTAPVGA
MNKLLDKVNWNKDEVDLFEINEAFAMVTMLAISELGLDANKVNVNGGACALGHPIGCSGS
RLLVTLIYALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagtccaatcaaaccaagatatcgttattgttgcagctaagcgcacccctatg
ggcggctttcaaggcgccttaagcggcgtggcatctcctgtattagcggccactgccatt
aaagacttattggaacaaacagggattgccgccagtgctgttaacgaagtactgatgggc
tgtgtgttgccagctggccttggccaagcgcctgcgcgtcaagcaaccttaggtgcaggc
ttacctttaagtgtcggcgccaccacagtgaacaaggtctgtggttcaggcatgaaaact
gtgatgttagcccacgatttaatcaaggccggtagcagtgaagtggtgattgcaggtggc
atggaaagcatgagtcaagcaccatacttgcttgataaagcccgctctggcatgcgcatg
ggccacggcaaagtcatggaccacatgtttttagatggcttagaagatgcctacacaggc
ggcgctatgggcacattcgcccaaaaaaccgccgatgactttaacctgagccgtgagcaa
atggatggttttgccctaagttcattagaaaaagccaatgccgccatcaattcaggtgcc
tttaaagcggaaattaccccagtaaccgtgagcgatcgccgcggtgatatcaccatagat
accgatgaacagccaggtaacgcacgtccagaaaaaatcccgacactgcgcccagccttc
accaaagacggcactattaccgccgctaattcgagctcaatttcagatggcgccgcggcg
ttaatgttaatgacaagggagaaagccagcagtttaggtcttgaggtgatggcgaccatt
aaaggccacagtactcacgcccaagagccgtcgttatttaccacagcgcccgtgggggcc
atgaacaagttgctggataaagtgaactggaacaaggatgaagtggatttatttgaaatc
aacgaagcctttgccatggtgaccatgttagccatttctgaactgggtttagatgccaac
aaggttaacgtcaatggcggcgcctgcgccttaggtcaccctattggctgctcaggctcg
cgcctgttggttaccttgatttatgcattgaaagcccgcggccttaagcgcggcgtggca
tcattatgcataggtggcggtgaagccacggccatggccattgaagtttaa

DBGET integrated database retrieval system