KEGG   Shewanella denitrificans: Sden_2000Help
Entry
Sden_2000         CDS       T00344                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00010  Glycolysis / Gluconeogenesis
sdn00071  Fatty acid degradation
sdn00350  Tyrosine metabolism
sdn00620  Pyruvate metabolism
sdn00625  Chloroalkane and chloroalkene degradation
sdn00626  Naphthalene degradation
sdn00650  Butanoate metabolism
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01120  Microbial metabolism in diverse environments
sdn01130  Biosynthesis of antibiotics
sdn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sden_2000
   00620 Pyruvate metabolism
    Sden_2000
   00650 Butanoate metabolism
    Sden_2000
  Lipid metabolism
   00071 Fatty acid degradation
    Sden_2000
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sden_2000
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sden_2000
   00626 Naphthalene degradation
    Sden_2000
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sden_2000
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sden_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 Trp_DMAT
Motif
Other DBs
NCBI-ProteinID: ABE55283
UniProt: Q12MP3
Position
2368315..2370939
Genome map
AA seq 874 aa AA seqDB search
MTVTNTQELDLLLERVAKAQAEYANFSQEQVDKIFRAAALAASDARISLAKMAATETGMG
VMEDKVIKNHFASEYIYNKYKDEKTCGILAEDLTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNGIVFSPHPRAKASTTTAARIVLDAAVKAGAPADIIGWIDEPSVALSNQ
LMTHDKINLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVIVVDSIYKQVKERFASHGGYLLSKAETKAMQGVILKNLGTTEMGLNAA
IVGQSAVAIAAMAGFTVPNNTKVLIGEVTDISHEEAFAHEKLSPLLGMYRAKDFNDAMDK
AEALVTLGGIGHTSGLYTDQDTQGERVKTFGFRMKTARILINTPASQGGIGDLYNFKLAP
SLTLGCGSWGGNSISENVGPSHLINKKTVAKRAENMLWHKLPSSIYFRRGSLPIALEELS
DKKRALIITDRFLFNNGYCNETLKILKAQGLETEVFYDVEADPTLAIVREGAKVAQSFQP
DVIIALGGGSPMDAAKIIWVMYEHPEVDFADLALRFMDIRKRIYTFPKMGVKAKMVAIPT
TSGTGSEVTPFAVVTDEVTGKKYPIADYQLTPNMAIIDPNLVMDMPKSLTAFGGIDAVTH
ALEAYVSVMANEYSDGQALQALDLLFKHLPDAYTLGANAPVAREKVHNGATIAGIAFANA
FLGVCHSMAHKLGAEFHLPHGLANALLINNVIRFNATDMPTKQAAFSQYDRPKALCRYAA
IADHLTLGGKTDAQKVEKLLEKIDELKETIGIPASIQAAGVKEADFIAKLDELAEEAFDD
QCTGANPRYPLISELKQVLLDSFYGRQYQDSVQS
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcactaacacccaggaacttgatctattgcttgagcgcgttgctaaggcccaa
gccgagtacgccaatttcagccaagaacaagtggataagatttttagagccgccgccctc
gctgcaagcgacgcgcgcatttcattagccaaaatggccgccacagaaaccggcatgggc
gtcatggaagacaaggtgattaaaaaccactttgcctcagagtacatttacaacaagtat
aaagacgagaaaacctgcggcatcttagccgaggacttaaccttcggcactattaccatc
gcagagcctgttggcatcatttgcggtattgtgcccaccacaaacccaacgtcaacggcc
atttttaaggcgcttatcagccttaaaacccgcaacggcatagtgttttcgccccaccct
cgcgccaaagcctccaccaccacggcggcgcgtatcgtgctagacgctgcggtgaaagcc
ggcgcgcctgccgatattatcggctggattgacgagcccagtgtcgcgctttcaaaccag
ttaatgacccacgacaagattaacttaattcttgccaccggcggtcctggcatggtgaaa
gcggcctattcttctggtaaacccgccataggtgtgggcgcaggtaatactcccatagtg
atcgatgaaaccgccgacattaagcgcgctgtcagctcaattttaatgtcaaaaaccttc
gacaatggggtggtgtgtgcctcggagcaagcggttatcgtggttgatagcatctacaag
caagtgaaagagcgttttgcaagccacggtggttacttgctctctaaggctgaaaccaag
gctatgcaaggggttatccttaaaaacttaggcaccacagagatggggttaaatgccgcc
atcgtaggccaaagcgctgtggctattgcggcaatggcgggctttaccgtgcctaataac
actaaggtgttgataggtgaagtgacagacattagccatgaagaagcctttgcccatgaa
aaattatcaccgctattgggcatgtaccgcgctaaagattttaatgatgctatggataaa
gccgaagccttagtgaccttgggcggcattggccatacatcaggcttatataccgaccaa
gacacccaaggcgagcgggtgaaaacctttggctttagaatgaaaaccgcccgcattcta
attaacaccccggcgtctcaaggcggcatcggcgatttatacaacttcaagctggcccca
tcactcaccttaggctgcggttcatggggtggtaactcgatttctgaaaacgtgggacct
agccacttaatcaataagaaaactgtcgctaagagggccgaaaacatgttgtggcacaag
cttccatcttctatctacttccgccgtggcagcttacccattgcccttgaggaactcagt
gacaagaaacgcgccctcatcatcacagatagattcttattcaataatggctactgcaac
gaaaccttaaaaattcttaaggcccaaggcttagaaactgaagtgttttatgatgtggaa
gccgatcccaccttagctatcgttagagaaggcgccaaagtggcccaaagcttccaaccc
gatgtgatcatcgccctgggcggcggctcgcctatggacgccgccaaaatcatttgggtc
atgtatgagcacccagaagttgattttgccgacttagccctgcgttttatggacatacgt
aaacgtatttacaccttccctaaaatgggcgtaaaagccaaaatggttgccattccaacc
acttctggcacggggtctgaagtgacgccctttgctgtggtcacagatgaagtgacaggt
aaaaaataccccatcgccgattaccaattaacccccaacatggctattattgatcctaat
ttggtgatggacatgccaaaatcattaaccgcgtttggtgggatagatgctgtcactcat
gcccttgaagcttatgtcagcgtgatggcgaacgagtacagtgatggtcaagcactgcag
gccttagacttattatttaagcacttgccagatgcatataccttaggggcaaacgcgccc
gtggcccgagagaaagtgcacaatggcgccaccatagccggtatcgcctttgctaatgct
ttcttgggtgtgtgtcactcaatggcccataagttaggcgccgagttccacctaccccat
ggtttggccaatgcgctattgatcaataacgtgatccgctttaacgccaccgacatgcca
accaagcaagcggcgtttagccaatacgacagaccaaaagccctgtgccgctacgcagcc
attgccgatcacttaacattaggtgggaaaaccgatgcgcagaaagtcgagaaattgctc
gagaaaatcgatgagctcaaggagacgattggcattcctgcatctatacaagcagcgggc
gtcaaagaagccgacttcatcgccaagctagatgagctggcagaagaagccttcgatgac
caatgtaccggtgccaacccaaggtaccccttgataagcgagctgaagcaagtgttatta
gacagcttctacggccgtcaatatcaagatagcgtgcaaagctaa

DBGET integrated database retrieval system