KEGG   Shewanella denitrificans: Sden_2660Help
Entry
Sden_2660         CDS       T00344                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00521  Streptomycin biosynthesis
sdn00523  Polyketide sugar unit biosynthesis
sdn01130  Biosynthesis of antibiotics
Module
sdn_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sden_2660
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sden_2660
Enzymes [BR:sdn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Sden_2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABE55939
UniProt: Q12KT7
Position
complement(3191413..3191952)
Genome map
AA seq 179 aa AA seqDB search
MKVIDTKIPDVKIIEPLVYGDERGFFMETWRQNEFEEKVAKKPCSFVQDNHTKSKKGILR
GLHYQTENAQGKLVRVVSGEVFDVAVDIRKDSLTYGQWVGVYLSAENKRQLWVPEGFAHG
FYVTSDEAEFVYKCTEYYNPSSEVSIFWDDKSLNIHWPLIDRPLLSSKDESLAIHFNQL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttattgatacaaaaatacccgatgtgaaaatcattgaaccactagtgtatggc
gatgaacgtggtttttttatggaaacatggcgacaaaatgaatttgaagaaaaagtcgcc
aaaaaaccttgctcttttgttcaagataatcacacaaaatctaagaaaggtattcttcga
ggtttgcattaccaaactgaaaatgctcaaggtaaacttgtacgcgttgtttccggtgag
gtgtttgatgtggcggttgatattagaaaagactcattaacatatggtcaatgggttggg
gtgtatttatctgccgaaaataagcgacaattatgggtgccagaagggtttgcccatggc
ttttatgtcaccagtgatgaggctgagtttgtctataaatgtactgaatattataaccct
agttcggaagtgagtatattttgggatgataaaagtttaaatattcactggccgttaatt
gataggcctttgttatcgagtaaagatgaaagcctagcaatacatttcaatcaattataa

DBGET integrated database retrieval system