KEGG   Shewanella denitrificans: Sden_3248
Entry
Sden_3248         CDS       T00344                                 

Definition
(GenBank) Gifsy-2 prophage; putative RecA/RadA recombinase
Organism
sdn  Shewanella denitrificans
SSDB
Motif
Pfam: DUF2190
Other DBs
NCBI-ProteinID: ABE56524
UniProt: Q12J52
Position
complement(3883182..3883502)
AA seq 106 aa
MNNLVCDGHTIDHTPTVDVASGATALIGKLVGVALGNVAANSEGTFVTTGVFELPKVSVD
DIGQGALVYLKSDNTVTTTASGNTLAGKAWADASNPSETVWVKINA
NT seq 321 nt   +upstreamnt  +downstreamnt
atgaacaatctagtttgtgatggtcacactattgatcacactcccacggtggatgttgct
agcggagccacagcgcttatcggaaaattggtgggcgttgctcttggtaatgttgccgca
aacagtgaaggcacatttgttaccacaggtgtgtttgagctacctaaagtcagtgttgat
gatatcggccaaggggctttagtatatttaaaatcggataacacagtgaccacaacggca
tcaggcaataccttggcgggtaaggcgtgggctgatgcatctaatccatccgaaacggtt
tgggtaaaaatcaatgcctaa

DBGET integrated database retrieval system