KEGG   Sulfitobacter donghicola: SD1155_02295Help
Entry
SD1155_02295      CDS       T05893                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
sdo  Sulfitobacter donghicola
Pathway
sdo00620  Pyruvate metabolism
sdo00630  Glyoxylate and dicarboxylate metabolism
sdo01100  Metabolic pathways
sdo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SD1155_02295
   00630 Glyoxylate and dicarboxylate metabolism
    SD1155_02295
Enzymes [BR:sdo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     SD1155_02295
    1.2.1.22  lactaldehyde dehydrogenase
     SD1155_02295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: QAV30472
UniProt: A0A410XV35
Position
446356..447798
Genome map
AA seq 480 aa AA seqDB search
MEVFEMTNQLFINNEFIESNSNETMDVINPATGEKIDTITFATKDEVNQAIEKSKQAQLE
WEKIPQPTRAEHVKLLIPLFEQNKDELAQLYVKEQGKTLAEAQGEIDKSIQFIDYMTSLS
MSNKGEVLQNSVENETIQLTKKPIGVTAGIVPWNAPILVLLRKVIPAIVTGCSVVIKPSE
ETTLLTLRLAQLFKASTIPAGLVQIVPGTGETVGTQLAQHKDIQLISLTGSMRAGKAVFE
NAASTVKKVNLELGGNAPVIVTPNANIDKAVDYIVTARIKNAGQVCTCPERIFVHEDIHD
TFVDKVTEKMKSLTVGDPLDDKTDFGAIINKTQLNSIDDKVQEAVQNGAKLVIGGHKLDR
PGYFYAPTVLDHVKQTDAVFKEEIFGPVLAITTYHNFEQVIDDANDTNAGLSSYIFSNDL
SEVMTATERLKFGEVYANCEAEEVVNGYHAGWRESGLGGADGIHGFEEYYNTTVSYIRYQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgtttgagatgacgaatcaattatttattaataacgaatttattgaaagtaac
tcgaatgaaactatggatgtgattaatccagctacaggagaaaagatagataccatcaca
ttcgcgacaaaggatgaagtcaatcaagctatcgaaaaatcgaaacaagcacaattagaa
tgggaaaaaatcccacaacctacccgtgctgaacatgttaaattgcttattcctctattt
gaacaaaataaagatgagcttgctcaattatacgttaaagaacagggtaaaacattagct
gaagctcaaggtgaaatcgataaatccatacaatttattgattatatgactagtttaagt
atgagtaataagggagaagtattacaaaatagtgtagaaaatgaaacaattcaacttact
aaaaagcctattggtgtcacagctggcattgtgccttggaatgcacctattttagtatta
ctacgtaaagtgattcctgctatcgtaacaggttgttctgtagttattaaaccaagcgaa
gaaacaacgttactcacattacgtcttgctcaactattcaaggcatctaccattcctgca
ggactcgttcaaattgtaccaggcacaggagaaacagtaggtacacaattagcacaacat
aaagacatccaacttatttcattaactggtagtatgcgtgctggtaaagcagtattcgaa
aatgcggcaagtacagttaaaaaagtcaatttagaacttggtggcaatgcaccagtgatt
gtcacacctaacgctaatatagacaaagctgtagattatattgtcactgcacgtattaaa
aatgcaggtcaagtatgtacatgcccggaacgaatttttgtgcatgaagatatccacgat
acatttgtagataaagtcacagaaaaaatgaaatctctcacagtcggagatccattagat
gataaaactgacttcggtgcgataatcaataaaacccaattaaatagtattgatgataaa
gtacaagaagcagtgcaaaatggcgctaaacttgtaataggtggtcacaaactagatcgt
cctggttacttctatgcaccaacagtacttgatcatgttaaacaaacagatgctgtattt
aaagaagaaatcttcggccctgttttagctatcacaacttaccacaactttgagcaagtc
atcgatgatgctaatgacactaatgccggactatcttcatatatcttttctaatgattta
tcagaagtcatgacagctacggaacgacttaaatttggtgaagtatatgccaattgtgaa
gcagaagaagttgtgaatggttatcatgccggttggagagaatctggtctaggtggtgcc
gatggtattcatggattcgaggaatattacaacactacagtgtcttatattagatatcaa
taa

DBGET integrated database retrieval system