KEGG   Sulfitobacter donghicola: SD1155_02340Help
Entry
SD1155_02340      CDS       T05893                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sdo  Sulfitobacter donghicola
Pathway
sdo00010  Glycolysis / Gluconeogenesis
sdo00071  Fatty acid degradation
sdo00280  Valine, leucine and isoleucine degradation
sdo00310  Lysine degradation
sdo00330  Arginine and proline metabolism
sdo00340  Histidine metabolism
sdo00380  Tryptophan metabolism
sdo00410  beta-Alanine metabolism
sdo00561  Glycerolipid metabolism
sdo00620  Pyruvate metabolism
sdo00625  Chloroalkane and chloroalkene degradation
sdo01100  Metabolic pathways
sdo01110  Biosynthesis of secondary metabolites
sdo01120  Microbial metabolism in diverse environments
sdo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SD1155_02340
   00053 Ascorbate and aldarate metabolism
    SD1155_02340
   00620 Pyruvate metabolism
    SD1155_02340
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SD1155_02340
   00561 Glycerolipid metabolism
    SD1155_02340
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SD1155_02340
   00310 Lysine degradation
    SD1155_02340
   00330 Arginine and proline metabolism
    SD1155_02340
   00340 Histidine metabolism
    SD1155_02340
   00380 Tryptophan metabolism
    SD1155_02340
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SD1155_02340
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SD1155_02340
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SD1155_02340
Enzymes [BR:sdo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SD1155_02340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh ERp29
Motif
Other DBs
NCBI-ProteinID: QAV30480
UniProt: A0A410XV37
Position
complement(454529..456022)
Genome map
AA seq 497 aa AA seqDB search
MANINVRDYIDERYGLFINNEFQQSETGETLTVTNPANGDELAEVAKASQKDVDKAVEAA
TNAFDSWSKISKEERADYLLEISRKIHENAERFATIESLQNGKPYRETSTIDVPMAANQF
KYFASVLTTDEGSVNEIDHNTMSLVVHEPVGVVGAVVAWNFPILLASWKLGPALAAGNTV
VIQPSSSTPLTLIELAKIFQEVLPKGVVNVLTGKGSESGDAIFNHEGVDKLSFTGSTDVG
YGVAKAGAERIVPTTLELGGKSANIIFDDANIEQVIEGVQLGILFNQGEVCSAGSRLLVQ
SSVYDKLLPKLKEAFENIKVGDPFADDIKMGSQTGGEQMEKIQSYVKLAEDDPNATILTG
GHRLTDNGRDKGFFFEPTIIELNDNSHQLAQEEIFGPVVVVEKFEDEQEAIQIANDSEYG
LAGGIFTTNLNRALNVAKAIRTGRIWINTYNQIPAGAPFGGYKKSGIGREVYKDAIKNYQ
QVKNIYIDTSNETKGLY
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattaacgtaagagattatatcgatgagcgttacggattatttattaataat
gaattccaacaaagtgaaactggagaaacgctgacagtgactaacccagcgaatggtgac
gaattagcggaagttgcaaaagcaagtcaaaaagacgtggataaagcagttgaagcggct
acaaacgcatttgatagttggagtaaaatttccaaagaagaacgcgcagactatttacta
gaaattagccgtaaaattcatgagaacgcagaacgattcgcgacaattgaatcattacaa
aatggtaaaccatatagagaaacatctacaattgatgtaccaatggcagcaaatcaattt
aaatattttgcaagtgtgttaacaactgatgaaggttcagtaaatgagattgatcacaat
acgatgagtttagttgtacatgaacctgtaggtgttgttggtgctgttgtggcatggaac
ttcccaattttattagcttcatggaagttaggtcccgcacttgcagcaggtaatactgtt
gtgattcaaccatcatcatcaacaccattaacactaattgaattagctaaaatcttccaa
gaagtattgccaaaaggtgttgtcaatgttttaactggtaaaggttctgaatcaggagac
gcgattttcaatcatgaaggtgttgataaattgtcattcactggttctacagatgtaggt
tatggcgtagctaaagcaggtgcagaacgtattgttcctacaacattagaacttggtggt
aagagtgccaatattatctttgacgatgcaaatattgaacaagtgattgaaggtgtgcaa
ttaggtattttattcaaccaaggtgaggtatgtagtgccggttctagattgctcgttcaa
tcatcagtgtatgacaaattactaccaaaattaaaagaagcatttgaaaacatcaaagtt
ggcgatccgtttgctgatgatattaagatgggaagtcaaactggtggagaacaaatggaa
aaaattcaaagctatgtgaaattagctgaagatgacccaaatgcaacgattcttacaggt
ggccacagacttactgataatggtcgagataaaggtttcttcttcgagccaacgattatt
gaattaaatgacaatagccatcagctagcacaagaagaaatttttggaccagtcgttgtt
gttgagaaatttgaagacgaacaagaggctattcaaattgccaatgattctgaatatgga
ttagcaggcggtatctttacaacgaatctaaaccgtgcattaaatgttgctaaagcgatt
cgaacaggacgtatctggattaatacgtacaaccaaattccagcaggcgcgccatttggt
ggatataaaaaatctggtattggtcgtgaagtatacaaagatgccattaaaaactatcaa
caagttaaaaatatctatatcgatacttcaaatgaaacaaaaggtctttattaa

DBGET integrated database retrieval system