KEGG   Sulfitobacter donghicola: SD1155_04350Help
Entry
SD1155_04350      CDS       T05893                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sdo  Sulfitobacter donghicola
Pathway
sdo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SD1155_04350
Enzymes [BR:sdo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SD1155_04350
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SD1155_04350
    1.1.1.-  
     SD1155_04350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C Pyr_redox AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QAV30850
UniProt: A0A410XW52
Position
897242..898279
Genome map
AA seq 345 aa AA seqDB search
MKAAVWYGQKDVRVEEREPKELQDNEVKVKVSWAGICGTDLHEYLEGPIFISTEKPDPFL
GQKAPVTLGHEFAGVVEETGSQVTKFNKGDRVVVNPTVSKREKEENIDLYDGYSFIGLGS
DGGFAEFTNAPEENVYKLPDNVSDKEGALVEPTAVAVQAIKEGEVLFGDTVAIFGAGPIG
LLTVVAAKAAGASKIFVFDLSEERLSKAKALGATHAINSGKSDPVDVVNKYTENGVDVSF
EVAGVAPTLKSSIDVTKARGTVVIVSIFGHPIEWHPMQLTNTGVKLTSTIAYTPTTFQQT
IDLINEGNLNVKDVVTDEIELENIVESGFEQLVNDKSQAKILVKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtttggtatggtcaaaaagatgtaagagttgaagaacgtgaacctaaa
gaattacaggacaatgaagttaaggttaaagtatcttgggcaggcatttgtggtacagat
ttacatgaatacttagaaggccctatatttatttcaacagaaaagccagatccattctta
ggccaaaaagcgccagttacattgggtcatgaatttgcaggtgtagtagaagaaactggt
tcccaagttacaaaatttaataaaggcgatcgagttgtagttaaccctacagtttcaaaa
cgtgaaaaagaagaaaatattgacctttatgatggttattcatttataggcttaggttct
gatggtggatttgcagagtttacaaatgcgccggaagaaaatgtttataaactaccagat
aatgtttctgataaagaaggtgcacttgtcgaaccaacagccgttgctgttcaagcaatt
aaagaaggtgaagttctatttggtgatactgtagctatttttggtgcaggaccaattgga
ttattaacagtcgtagcagccaaagcagctggtgcaagtaaaatatttgttttcgattta
tcagaagaaagactaagtaaagctaaagcactaggcgcgactcatgctataaactctggt
aagtcagatccagttgatgttgttaataagtacacagaaaatggtgtagatgtatctttt
gaagtggctggtgtagcaccaacactaaaatcttctatagatgttacaaaagcgagaggt
acagttgttatcgtttctatttttggacatcctatcgagtggcatccaatgcaattaact
aatacaggagtaaaacttacttctacaattgcatacacacctactacattccaacaaaca
attgacttaatcaacgaaggtaatttaaacgttaaagatgtagttactgatgaaattgag
ttagaaaatatcgtagaatcaggatttgaacaacttgtaaatgataaatctcaagcaaaa
attttagttaaattataa

DBGET integrated database retrieval system