KEGG   Sulfitobacter donghicola: SD1155_10865Help
Entry
SD1155_10865      CDS       T05893                                 

Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
sdo  Sulfitobacter donghicola
Pathway
sdo00740  Riboflavin metabolism
sdo00790  Folate biosynthesis
sdo01100  Metabolic pathways
sdo01110  Biosynthesis of secondary metabolites
Module
sdo_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:sdo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SD1155_10865
   00790 Folate biosynthesis
    SD1155_10865
Enzymes [BR:sdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SD1155_10865
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SD1155_10865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: QAV32062
UniProt: A0A410XZN2
Position
complement(2284049..2285230)
Genome map
AA seq 393 aa AA seqDB search
MKFDSIELALEALKQGESIIVVDDEDRENEGDLIAITEWMKDDTINFMAREGRGLICTPI
SSSISEHLDLHPMESNNSDVFGTNFTVSIDHKNTTTGISANERTLTARALIDEHAKASDF
NRPGHLFPLIAKDNGVLERNGHTEAAVDLAKLTGAKPAGVICEIMNDDGSMAKGEDLQAF
KEKHQLVMITIESLIEYRQVNESHVKLNAKVKMPTDFGTFDMYGFTTDYSEEEIVVITKG
DIRSHENVRIHSACLTGDIFHSQRCDCGAQLEASMNYIEQHGGMIIYLPQEGRGIGLMNK
LRAYELIEKGYDTVTANLALGFDEDLRDYNIAAQILKYFEIEKVNLLSNNPKKFEGLKEY
GINIQQRIEVIVPETQYNHDYMTTKKEKMGHLI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgacagtattgaattagccttagaagctttaaaacaaggtgaaagtattatt
gtagttgatgatgaagatcgagaaaatgaaggcgacttaatagcaataactgaatggatg
aaagacgatacaattaatttcatggctagagaaggtcgtgggttaatttgtacacctatc
agttcaagtattagtgaacatttagatctccatccgatggaatcaaataactcagacgtg
tttgggactaattttactgtaagtatcgatcataagaatacaacaacaggtatcagtgcg
aatgagagaacactaactgcaagagcgctaatcgatgagcatgcaaaagcttcagatttt
aaccgtccgggtcatttatttcctttaattgctaaagataatggtgtgttagaaagaaat
gggcatacagaggcggcagtagatcttgctaaattaacaggtgctaaacctgcaggtgtg
atttgtgaaattatgaatgatgatgggtctatggctaagggtgaagatctccaagcattt
aaagagaaacatcaattagttatgattacgattgaaagtttaatagaatatcgtcaagtt
aatgaatcacatgtaaaactcaatgcgaaagtaaaaatgccaaccgattttgggacattt
gatatgtatggttttacaaccgattatagtgaagaagaaatcgtcgttataactaaagga
gatattagatcacatgaaaatgtacgtatccattctgcatgccttacgggtgatattttc
catagccagcgatgtgattgtggcgctcaattagaagcttcgatgaattatattgagcaa
cacggtggtatgattatctatttacctcaagaaggtcgtggcattggacttatgaataaa
ttgcgtgcctatgaattaattgaaaaaggttatgatactgttacagctaatttagcatta
ggattcgatgaagatttacgagattataatatagctgcacagattcttaaatattttgaa
atagaaaaagtaaatttattaagtaataatccaaagaaatttgaaggattaaaagaatat
ggcattaatattcaacaacgtatagaagtgattgtaccagaaacacaatataatcatgac
tatatgacaactaaaaaagaaaaaatgggacatttaatttag

DBGET integrated database retrieval system