KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_1760Help
Entry
SDSE167_1760      CDS       T02870                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
sdq00071  Fatty acid degradation
sdq00072  Synthesis and degradation of ketone bodies
sdq00280  Valine, leucine and isoleucine degradation
sdq00310  Lysine degradation
sdq00362  Benzoate degradation
sdq00380  Tryptophan metabolism
sdq00620  Pyruvate metabolism
sdq00630  Glyoxylate and dicarboxylate metabolism
sdq00640  Propanoate metabolism
sdq00650  Butanoate metabolism
sdq00900  Terpenoid backbone biosynthesis
sdq01100  Metabolic pathways
sdq01110  Biosynthesis of secondary metabolites
sdq01120  Microbial metabolism in diverse environments
sdq01130  Biosynthesis of antibiotics
sdq01200  Carbon metabolism
sdq01212  Fatty acid metabolism
sdq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sdq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDSE167_1760 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SDSE167_1760 (atoB)
   00640 Propanoate metabolism
    SDSE167_1760 (atoB)
   00650 Butanoate metabolism
    SDSE167_1760 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SDSE167_1760 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SDSE167_1760 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SDSE167_1760 (atoB)
   00310 Lysine degradation
    SDSE167_1760 (atoB)
   00380 Tryptophan metabolism
    SDSE167_1760 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SDSE167_1760 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SDSE167_1760 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SDSE167_1760 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdq04147]
    SDSE167_1760 (atoB)
Enzymes [BR:sdq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SDSE167_1760 (atoB)
Exosome [BR:sdq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SDSE167_1760 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAN94136
Position
1578046..1579233
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLATQSIMLGDAAIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYAISREEQDQFAL
ESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTITAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVARGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagatatggtttgcggttctggacttaaagcaatccaattagctacgcaa
agcatcatgcttggtgacgctgctatcgttattgctggtggtgtggaaaacatgtcacag
gcagcctatgtgtcaactcagcaccggtttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggtttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatgccatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctaaggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagatcctttaattgttacgacggatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccattactgctggaaatgcctcaggaataaatgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgacttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gtgaatgggggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtggccagaggactagcaacactttgc
attggtggaggtcaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system