KEGG   Sulfuricella denitrificans: SCD_n00630Help
Entry
SCD_n00630        CDS       T02857                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sdr  Sulfuricella denitrificans
Pathway
sdr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sdr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SCD_n00630 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sdr03011]
    SCD_n00630 (rplV)
Ribosome [BR:sdr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SCD_n00630 (rplV)
  Bacteria
    SCD_n00630 (rplV)
  Archaea
    SCD_n00630 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Zot
Motif
Other DBs
NCBI-ProteinID: BAN34472
UniProt: S6B197
Position
641302..641634
Genome map
AA seq 110 aa AA seqDB search
MMRVSAVLRGTRLSAQKGRLVADQIRGLPVDRALNILTFSPKKGAVIIKKVLESAIANAE
HNEGADIDELKVATILVDEGSTMKRFRARAKGRGARILKPTCHITVTVGN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgatgagagttagtgctgtattacgcggtaccaggctgtcggcgcaaaaaggccgactg
gttgccgatcagattcgcggactgcccgttgaccgcgcattgaacatcctgacctttagt
ccgaagaagggtgcagtgattatcaagaaagtgctggagtctgctattgctaacgccgag
cataatgagggtgctgacattgatgaactcaaggtcgcgaccatactagtggacgagggt
tcgacgatgaagcgtttccgtgcacgtgcgaaaggtcgaggggcgagaattctcaagcct
acctgtcatatcacagtcactgtcggaaactaa

DBGET integrated database retrieval system