KEGG   Sulfuricella denitrificans: SCD_n00688Help
Entry
SCD_n00688        CDS       T02857                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sdr  Sulfuricella denitrificans
Pathway
sdr00020  Citrate cycle (TCA cycle)
sdr00480  Glutathione metabolism
sdr01100  Metabolic pathways
sdr01110  Biosynthesis of secondary metabolites
sdr01120  Microbial metabolism in diverse environments
sdr01200  Carbon metabolism
sdr01210  2-Oxocarboxylic acid metabolism
sdr01230  Biosynthesis of amino acids
Module
sdr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCD_n00688 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCD_n00688 (icd)
Enzymes [BR:sdr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SCD_n00688 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAN34530
UniProt: S6A9Q7
Position
693510..694748
Genome map
AA seq 412 aa AA seqDB search
MTQKFQVPQQGSKITVNADFSLNVPDNPIIPFVEGDGTGVDITPVMRKVVDAAVDKSYGG
KRKIAWMEIYAGEKATKVYDPDTWLPDETVQAIREYVVSIKGPLTTPVSGGIRSLNVALR
QMLDLYVCLRPVRYFKGVPSPVKEPEKTDMVIFRENTEDIYAGVEWEAGSPEVKKVIEFL
QKEMGVSKIRFPESSAIGVKPVSIEGSERLVRRAIQYAIDNKRSSVTLVHKGNIMKFTEG
GFKKWGYELAQREFGAELLDGGPWMKLPNGIVIKDVIADAFLQQILLRPDEYDVVATLNL
NGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSIILSAEMML
RHMGWIEAADLIVKSMEQAINAKTVTYDFARLMPGATQVSCSAFGQAMIERM
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaaaatttcaagtgccgcagcagggcagcaaaattacggtgaatgccgatttt
tccctgaatgtgccggacaatccgattattcccttcgttgagggcgacggcaccggcgtg
gacattacgccggtgatgcgcaaggtggtggatgcggcggtagataagtcctatggtggc
aagcgcaagatcgcctggatggaaatctatgccggcgagaaagccaccaaggtttatgat
cccgatacctggttgcccgatgaaaccgtgcaggcgatcagggaatatgtggtgtcgatc
aagggacccttgaccacgccggtgtcgggcggtatccgctcgctcaacgtagcgctgcgc
cagatgctcgatctctatgtctgcctgcggccagtgcgctatttcaagggcgtgccgagc
ccggtcaaggagccggaaaagaccgacatggtgattttccgtgagaataccgaggatatc
tacgcaggtgttgaatgggaagccggttcaccggaagtaaaaaaagtcatcgagtttctg
cagaaggaaatgggtgtgagcaaaatccgctttccggaatcctcggcgatcggcgtcaag
ccggtgtcgatcgagggtagcgagaggctagtgcgcagggcgatccagtacgccatcgat
aataagcgcagctcggtgaccctggtgcacaagggcaacatcatgaagttcaccgagggc
ggcttcaagaagtggggctatgagctggcccagcgcgagttcggcgccgaactactggac
ggcgggccatggatgaaattgcccaatggcatcgtgatcaaggacgtgattgccgatgct
ttcctgcagcagattctgttgcggccggacgaatacgacgtggttgctaccctgaacctg
aacggggattacatttccgacgcactggcagctcaggtaggtggcatcggcattgcaccg
ggcgcaaatctttccgatagcgtggcgatgttcgaagcaactcacggtacggcgccaaag
tatgccggcaaagattatgtcaatcccggttctatcatcctgtctgccgagatgatgctg
cgccatatgggatggatcgaggcggctgatttaatcgtcaagtcgatggagcaggcaatc
aacgccaaaacggtaacctacgattttgcgcggttgatgcccggtgcgacccaggtgtcc
tgttcggctttcggtcaggcgatgatagagcggatgtag

DBGET integrated database retrieval system