KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1883
Entry
SDEG_1883         CDS       T00932                                 
Symbol
ssb2
Name
(GenBank) single-strand DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds03030  DNA replication
sds03430  Mismatch repair
sds03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sds00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SDEG_1883 (ssb2)
   03430 Mismatch repair
    SDEG_1883 (ssb2)
   03440 Homologous recombination
    SDEG_1883 (ssb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sds03032]
    SDEG_1883 (ssb2)
   03400 DNA repair and recombination proteins [BR:sds03400]
    SDEG_1883 (ssb2)
   03029 Mitochondrial biogenesis [BR:sds03029]
    SDEG_1883 (ssb2)
DNA replication proteins [BR:sds03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SDEG_1883 (ssb2)
DNA repair and recombination proteins [BR:sds03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     SDEG_1883 (ssb2)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    SDEG_1883 (ssb2)
Mitochondrial biogenesis [BR:sds03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    SDEG_1883 (ssb2)
SSDB
Motif
Pfam: SSB tRNA_anti-codon Cyclin_C_2 tRNA_anti_2 Phage_SSB
Other DBs
NCBI-ProteinID: BAH82365
UniProt: C5WJ00
Position
1:complement(1812971..1813462)
AA seq 163 aa
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRTFKSQNGEREADFINCVIWRQPAEN
LANWAKKGALIGVTGRIQTRNYENQQGQRVYVTEVVADNFQMLESRATREGGSTGSFNGG
FNNNTSSSNSYSAPAQQTPNFGRDDSPFGNSNPMDISDDDLPF
NT seq 492 nt   +upstreamnt  +downstreamnt
atgattaataatgtagtactagttggtcgtatgaccaaggatgcagaacttcgttacaca
ccaagtcaagtagctgtggctaccttcacacttgctgttaaccgtacctttaaaagccaa
aatggtgaacgcgaggcagatttcattaactgtgtgatctggcgtcaaccggctgaaaat
ttagcgaactgggctaaaaaaggtgctttgatcggagttacgggtcgtattcagacacgt
aactacgaaaaccaacaaggacaacgtgtctatgtaacagaagttgttgcagataatttc
caaatgttggaaagtcgtgctacacgtgaaggtggctcaactggctcatttaatggtggt
tttaacaataacacttcatcatcaaacagttactcagcgcctgcacaacaaacgcctaac
tttggaagagatgatagcccatttgggaactcaaacccgatggatatctcagatgacgat
cttccattctag

DBGET integrated database retrieval system