KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0413Help
Entry
SDEG_0413         CDS       T00932                                 

Gene name
glr
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00471  D-Glutamine and D-glutamate metabolism
sds01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sds00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SDEG_0413 (glr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sds01011]
    SDEG_0413 (glr)
Enzymes [BR:sds01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SDEG_0413 (glr)
Peptidoglycan biosynthesis and degradation proteins [BR:sds01011]
 Precursor biosynthesis
  Racemase
   SDEG_0413 (glr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF2183
Motif
Other DBs
NCBI-ProteinID: BAH80915
UniProt: C5WEV0
Position
1:389421..390218
Genome map
AA seq 265 aa AA seqDB search
MMDTRPIGFLDSGVGGLTVVRELMRQLPHEKVVYIGDSARAPYGPRPAEQIREYTWDLVR
FLLTKNVKMIVFACNTATAVAWEEVKEALDIPVLGVILPGSSAAIKSTTKGQVGVIGTPM
TIASDIYRQKIQLLAPTVEVASLACPKFVPIVESNEIRSSVAKKVVYESLTPLVGKIDTL
VLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFEINGSRCQEKVKHHFYTT
ASPEIFQEIASVWLNQKIDVEHVTL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgatggatacaagaccaattggttttttagattctggtgtgggaggtttgaccgtagtt
cgtgagttgatgcggcaacttcctcatgaaaaagtggtatatattggtgattcagctagg
gccccttatggtccaagacctgctgagcaaattagagaatacacatgggatcttgtccgt
tttttgctgaccaaaaatgtgaaaatgattgtttttgcttgtaatacagcaacagcagta
gcttgggaagaggtcaaagaagctctggacatccctgttttaggtgtgattttacctgga
tcaagtgcagcaataaaatcgacaaccaaaggtcaggttggtgtgattggaacaccgatg
acaatagcttcggacatttaccgtcaaaaaattcaattactagcaccaacagtagaggtg
gctagcctagcttgtcctaaatttgtccccattgtcgagtctaatgaaatacgttctagc
gtcgctaaaaaagtcgtctatgaaagtttgacgcccttggtgggtaaaattgacacgctc
gttctaggctgtacgcattaccctctgcttcgtccgattattcaaaacgttatggggccg
tcggtcaagttgatcgatagcggggcagaatgtgttcgggatatttctgttcttttaaac
tactttgaaattaatggtagtcgctgtcaagaaaaggtaaaacaccatttttacacaacg
gcaagtcctgaaatctttcaagagattgcctcagtatggttaaaccaaaaaatagatgtg
gagcatgtgaccttatga

DBGET integrated database retrieval system