KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0473Help
Entry
SDEG_0473         CDS       T00932                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00450  Selenocompound metabolism
sds00970  Aminoacyl-tRNA biosynthesis
sds01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sds00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SDEG_0473 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SDEG_0473 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sds01007]
    SDEG_0473 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sds03016]
    SDEG_0473 (metS)
Enzymes [BR:sds01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SDEG_0473 (metS)
Amino acid related enzymes [BR:sds01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SDEG_0473 (metS)
Transfer RNA biogenesis [BR:sds03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SDEG_0473 (metS)
 Prokaryotic type
   Other AARSs
    SDEG_0473 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: BAH80975
UniProt: C5WF10
Position
1:443739..445739
Genome map
AA seq 666 aa AA seqDB search
MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTK
AAEAGISPQTYVDNMAKDVKDLWQLLDISYDKFIRTTDDYHEEVVAAVFEKLLAQDDIYL
GEYSGWYSVSDEEFFTESQLEEVFRDEDGKVIGGIAPSGHQVEWVSEESYFLRLSKYADR
LVAFFKEQPDFIQPDGRMNEMLKNFIEPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDA
LLNYATALGYGQMDHANFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDLPMPERLIAH
GWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYE
LANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDTELSQLIDAQLADYHKYMEAVDYPR
ALEAIWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHLIQPFMMETS
AAIMTQLGLEPVSDLSVLALADFPDNTKVVAKGTPIFPRLDMEAEIDYIKAQMGSSSAIS
QEKEWIPEDVELKSEKDDITFETFDAVEIRVAEVKEVSKVEGSDKLLRFRLDAGDGEDRQ
ILSGIAKFYPNEQELVGKKLQIVANLKPRKMMKKYISQGMILSAEHGDQLTVLTVDPSVA
NGSVIG
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaccattttacattacgacacccatctactacccatctggtaaactacac
atcggttctgcctataccaccattgcctgtgatgttttggcacgctacaagcgcttgatg
ggacatgaagtcttctatctcacaggacttgatgaacatgggcaaaagattcaaaccaag
gcagcagaagcaggtattagccctcaaacttatgttgataacatggcaaaggatgtcaaa
gacctttggcaattgctagatatttcttatgataaatttatccggacaactgacgattac
cacgaagaagtcgttgctgctgtttttgaaaaattactggcgcaagatgacatttacctt
ggtgaatactctggttggtattctgtctctgatgaagaattcttcactgaaagccaacta
gaagaagtttttagagatgaagacggtaaggttattggagggattgctccttctggtcac
caagtagagtgggtatcagaagaatcttacttcctacgccttagcaagtacgctgaccgc
ctcgtagccttctttaaagagcaacctgactttatccaaccagatggtcgtatgaatgaa
atgttgaaaaactttattgagccaggtctagaagatttagcagtcagtcgcactaccttc
acttggggtgtacctgttccatcaaatccaaaacacgtggtttatgtgtggattgatgcc
ctcttaaactatgcgacagcccttggttatggtcaaatggaccatgctaactttgacaaa
ttctggaatggaacggttttccatatggttggaaaagatatcttgcgtttccacagtatc
tactggccaatcttgctgatgatgcttgatctaccaatgccagaacgcttaattgctcat
ggttggtttgttatgaaagacggtaaaatgtctaaatcaaaaggtaatgtggtttaccca
gaaatgttagttgagcgatttggacttgatcctcttcgttattacctcatgcgttccttg
ccggttggttcagacggtacctttacccctgaagattatgtgggtcgtattaactatgaa
ttggccaacgatcttggtaatttattgaatcgtaccgttgccatgatcaacaagtatttt
gatggcacggtgccagcttacgttgacaacgggactgcctttgatactgagttaagtcag
ttgatcgatgctcagttggccgactatcataagtacatggaagcggtggattacccacgc
gccttagaagccatttggactatcattgctcgtaccaacaaatacattgatgagacagct
ccttgggtgctagctaaagaagatggagacaaagctcaattggccagtgtcatggcacac
ttggcagccagcttgcgtgtggttgctcatttgattcaaccatttatgatggaaacatca
gctgctatcatgacacaacttggtttggaacctgtttctgatttgtcagttcttgcttta
gcagattttcctgacaatacaaaggttgttgccaaagggacaccgattttcccacgtctt
gacatggaagctgaaatcgactatatcaaagctcaaatgggtagtagctcagctatttcc
caagaaaaagaatggatacctgaagatgtcgagctcaaatctgaaaaagacgacatcaca
tttgaaaccttcgatgctgtggaaattcgtgtggcagaagtcaaggaagtatcaaaagtg
gaaggttccgataaattgcttcgttttagattagatgcaggggatggggaagaccgtcaa
atcttgtcaggtattgccaaattctatcccaacgaacaagaattagttggcaaaaaacta
caaattgttgctaatctcaaacctcgtaaaatgatgaaaaaatacatcagtcaagggatg
attctatcagcagagcatggggatcagctaacggttttaaccgttgatccatctgtcgca
aatggaagtgtgattggttaa

DBGET integrated database retrieval system