KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0561Help
Entry
SDEG_0561         CDS       T00932                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00071  Fatty acid degradation
sds00072  Synthesis and degradation of ketone bodies
sds00280  Valine, leucine and isoleucine degradation
sds00310  Lysine degradation
sds00362  Benzoate degradation
sds00380  Tryptophan metabolism
sds00620  Pyruvate metabolism
sds00630  Glyoxylate and dicarboxylate metabolism
sds00640  Propanoate metabolism
sds00650  Butanoate metabolism
sds00900  Terpenoid backbone biosynthesis
sds01100  Metabolic pathways
sds01110  Biosynthesis of secondary metabolites
sds01120  Microbial metabolism in diverse environments
sds01130  Biosynthesis of antibiotics
sds01200  Carbon metabolism
sds01212  Fatty acid metabolism
sds02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDEG_0561
   00630 Glyoxylate and dicarboxylate metabolism
    SDEG_0561
   00640 Propanoate metabolism
    SDEG_0561
   00650 Butanoate metabolism
    SDEG_0561
  Lipid metabolism
   00071 Fatty acid degradation
    SDEG_0561
   00072 Synthesis and degradation of ketone bodies
    SDEG_0561
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SDEG_0561
   00310 Lysine degradation
    SDEG_0561
   00380 Tryptophan metabolism
    SDEG_0561
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SDEG_0561
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SDEG_0561
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SDEG_0561
Enzymes [BR:sds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SDEG_0561
Exosome [BR:sds04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SDEG_0561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAH81063
UniProt: C5WF98
Position
1:531308..532429
Genome map
AA seq 373 aa AA seqDB search
MTMTDIYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPAPIDQVICGNAVGTGG
NIGRLMTLYSHLGESVPALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPE
SVYASADWRQGPYKVAQFSPDTNSPFAMIEGAERVAREHGFTKEYLNHWTLKSHQKASYC
QEQALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEGHVISAANACLTHDAAAFLQL
SSQPSAFKLIDVVEVAGDPQRSPLMVVTASQVLLAKHGLGMADMTAIEWNEAFAVIDGLF
ETHYPDLLDRYNIFGGALAYGHPFGASAAIILLHLMKALEIKEGRYGLAAIPAAGGQGIA
FLVECNQEWCNAN
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacggatatttatattgctgcaggccttagaacccctatcggtttagtaggg
aaacaatttgctaaagaacaaccagaaatccttggagcaaagctcatcaatgctttacaa
aataagtatccagctcctattgaccaagtaatttgtggcaatgccgtcggaactggtggt
aatattgggcgcttgatgaccctgtattctcatttaggagaatctgtccctgctttgacg
gttgatatgcaatgtgcttcggctggtgcagctctttccgtgggttatgctaaaatcaag
gcaggtatggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaa
tcggtatatgcttcagctgattggcgccaaggcccttacaaagttgcccagttctctccg
gacaccaacagtccatttgcgatgattgagggggcagaacgagtggcaagagaacatggc
tttacaaaggagtatttgaatcactggacattgaagagtcatcaaaaggctagttattgc
caggagcaagccctgttagctgatcttattctagacctgccaggtgctagtgatcaaggt
attcgaccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagagggt
cacgtgattagtgcagccaatgcctgcctcacccatgatgctgctgcctttttacagcta
agtagtcagccttcagcttttaaacttattgatgtggtagaagtagcaggagacccacag
cgtagccccttaatggtggttacagctagtcaagtccttttggcaaaacatggcctaggg
atggcagatatgacagcgattgaatggaacgaagcctttgccgttattgatggtttattt
gaaacccattacccagatttattggaccgctataatatatttggaggagctttggcctac
gggcatccttttggagcttcggcagctattattctcttacatttaatgaaggctttagaa
attaaggaaggacggtatggattggcagctattccagcagcgggagggcagggaattgcc
ttcttggtagaatgcaatcaggagtggtgcaatgctaactag

DBGET integrated database retrieval system