KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1700Help
Entry
SDEG_1700         CDS       T00932                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00071  Fatty acid degradation
sds00072  Synthesis and degradation of ketone bodies
sds00280  Valine, leucine and isoleucine degradation
sds00310  Lysine degradation
sds00362  Benzoate degradation
sds00380  Tryptophan metabolism
sds00620  Pyruvate metabolism
sds00630  Glyoxylate and dicarboxylate metabolism
sds00640  Propanoate metabolism
sds00650  Butanoate metabolism
sds00900  Terpenoid backbone biosynthesis
sds01100  Metabolic pathways
sds01110  Biosynthesis of secondary metabolites
sds01120  Microbial metabolism in diverse environments
sds01130  Biosynthesis of antibiotics
sds01200  Carbon metabolism
sds01212  Fatty acid metabolism
sds02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDEG_1700 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SDEG_1700 (atoB)
   00640 Propanoate metabolism
    SDEG_1700 (atoB)
   00650 Butanoate metabolism
    SDEG_1700 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SDEG_1700 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SDEG_1700 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SDEG_1700 (atoB)
   00310 Lysine degradation
    SDEG_1700 (atoB)
   00380 Tryptophan metabolism
    SDEG_1700 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SDEG_1700 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SDEG_1700 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SDEG_1700 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sds04147]
    SDEG_1700 (atoB)
Enzymes [BR:sds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SDEG_1700 (atoB)
Exosome [BR:sds04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SDEG_1700 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: BAH82183
UniProt: C5WIG8
Position
1:1633842..1635029
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLATQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAARALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLATIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVARGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagatatggtttgcggttctggacttaaagcaatccaattagctacgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtggaaaacatgtcacaa
gcagcttatgtctcaactcagcaccgctttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggcttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctagggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagatcctttaattgttacgacggatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctggaaatgcctcaggaataaatgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagccactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgacttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gtgaatgggggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtggccagaggactagcaacactttgc
attggtggaggtcaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system