KEGG   Staphylococcus pseudintermedius ED99: SPSE_0163Help
Entry
SPSE_0163         CDS       T02008                                 

Gene name
mqo2
Definition
(GenBank) malate:quinone-oxidoreductase 2
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00020  Citrate cycle (TCA cycle)
sdt00620  Pyruvate metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
Module
sdt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sdt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSE_0163 (mqo2)
   00620 Pyruvate metabolism
    SPSE_0163 (mqo2)
Enzymes [BR:sdt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SPSE_0163 (mqo2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ADX75510
Position
complement(179979..181472)
Genome map
AA seq 497 aa AA seqDB search
MPTQSEPKDIVIIGAGVLSTTFASMIKDLEPEWNLKLYERLDSPGVESSNERHNAGTGHA
ALCELNYTVKQPDGSIDIEKAKEINEEFEISKQFWSHLVKSKNIDTPRDFINPLPHISFV
RGKNNVQFLKDRYNKMKDFPMFDNIEYTEDIEVMRKWMPLMMQGRSASDIMAASKIDEGT
DVNFGELTRKMAKSIEAHKNADVHYNHEVRDFNRRKDGKWEVTVVNRNTGESHVQLADYI
FIGAGGGAIPLLQKTGIPESKHLGGFPITGQFLMCTNPDVIEEHGVKVYGKEPPGTPPMT
VPHLDTRYINGRKALLFGPFASIGPKFLKNGSNLDLFKSVKPYNITTLLAAAVKNLPLIK
YSIDQILMTKEGCMNHLRTFYPEAKDQDWELYTAGKRVQVIKDTEEYGKGYIQFGTEVVN
SQDHTVIALLGESPGASTSVSVALEVLERNFAEYVPEWTPKLQEMIPSYGKSLIEDVDLM
RKIRQQTSKDLELNYYE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgccaactcaatcagaacctaaagacattgtcattattggtgccggtgtgctaagtacg
actttcgcttcaatgattaaagatttagaaccagaatggaatcttaaattatatgaacgc
ctagacagtccaggtgtagaaagttcaaacgagcgtcataatgctggtactggccatgct
gcactttgtgaattgaactatacagtgaaacaacctgatggctcaattgacatcgaaaaa
gcaaaagaaatcaatgaagaattcgaaatctcaaaacaattttggagtcatcttgttaaa
agtaaaaacattgatacaccaagagatttcatcaatcctcttccacacattagcttcgta
cgcgggaagaataacgttcaattcttaaaagatcgttataataaaatgaaagatttccca
atgttcgacaatattgaatatacagaagatattgaagtgatgagaaaatggatgccgttg
atgatgcaaggtcgtagtgctagcgacatcatggctgcaagtaaaatcgacgaaggtact
gatgttaacttcggtgaattaactcgtaaaatggctaaaagtatcgaagcgcataaaaat
gcagatgtacattataaccatgaagttagagacttcaaccgtcgtaaagatggtaaatgg
gaagttacagtggtcaaccgcaatacaggtgagtcacatgtacaacttgcagactatatc
ttcatcggtgctggtggcggtgcgattccgttgttacaaaaaacaggtattcctgaaagt
aaacatttaggtggtttcccaattacaggacaattcttaatgtgtacaaacccagatgtt
atcgaagaacatggtgtgaaagtatacggtaaagagccacctggtacaccaccaatgact
gtacctcacttagatacacgttatatcaacggccgtaaagcattattattcggacctttc
gcaagcatcggtcctaaattcttgaaaaatggttcgaacttagatttattcaaatctgta
aaaccatacaatattactactttacttgccgctgcggtgaaaaacttaccgttaattaaa
tactcaatcgatcaaatcttaatgactaaagaaggttgtatgaaccacttacgtacattc
taccctgaagctaaagatcaagattgggaattatatactgctggtaaacgtgtacaagtg
attaaagatactgaagaatacggtaaaggttacatccaattcggtacagaagtggtaaac
tcacaagaccatactgttattgctttattaggtgaatcaccaggagcttctacatcagtg
tctgtggcacttgaagtattagaacgcaactttgctgaatacgtacctgaatggacacct
aaattacaagaaatgattccttcttatggtaaatcattaattgaagatgttgatttaatg
agaaaaatacgtcaacaaacttcaaaagacttagaattaaactactacgagtaa

DBGET integrated database retrieval system