KEGG   Staphylococcus pseudintermedius ED99: SPSE_0533Help
Entry
SPSE_0533         CDS       T02008                                 

Definition
(GenBank) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00520  Amino sugar and nucleotide sugar metabolism
sdt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPSE_0533
Enzymes [BR:sdt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     SPSE_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ADX75868
Position
complement(608206..609087)
Genome map
AA seq 293 aa AA seqDB search
MHENLKGLYAALLVPFDENGQVKEQGLRAIIRNAIDEQQLDGLYVNGSSGENFLMNTEQK
KEVFRITKDEAKDDIRLIAQVGSLDLNEAIELGQYATELGYDSLSAVTPFYYPFTFEEIR
DYYFAIIEATQNNMIVYSIPGLTGVNISIQQFEELFQNDKVIGVKYTAPDFYLLERLRQA
FPDKLIFSGFDEMLVQAAISGVDGAIGSTFNVNGRRIRQIFEHAQNGSVEEAYRIQHDTN
DIIETVLSMGLYPTLKAILAEKGIDTGVPKAPFHPFNEAHRDALKTLINQYQL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaatttaaaaggtttatatgcagctttactcgtcccatttgatgaaaacgga
caagtgaaagaacaaggtttaagagcgattatccgtaacgcgattgacgaacaacagtta
gatggtttatatgttaacgggagctcaggcgaaaactttttaatgaataccgaacaaaag
aaagaagttttccgcattacgaaagatgaagcaaaagacgatattcgcttaattgcacaa
gtcggttcattagatttaaacgaagcgattgaattgggtcaatatgcgacagaactcggt
tatgattcattatcagcagttacaccgttttactatccattcacgtttgaagaaattcgt
gactattatttcgctattattgaagcgactcaaaacaatatgattgtgtactctattcct
ggattaactggtgtaaatatttcaatccaacaatttgaggagcttttccaaaacgataaa
gtaatcggcgtcaaatatacagcacctgatttttatttactcgaacgcttacgtcaagca
ttcccagataagttaattttctctggttttgatgaaatgctcgtacaagctgcgatttca
ggcgttgatggcgcaatcggctcgacgttcaatgtcaatggtcgtcgcattcgtcaaatt
tttgaacatgctcaaaatggctcggttgaagaggcttatcgcattcaacatgacacgaat
gatattatcgaaacggtactgagcatgggcttatatccaacattgaaagccattttagct
gaaaaagggattgatacaggtgtaccaaaagcaccattccatccgtttaacgaagcacat
cgcgacgcattgaaaacattgatcaaccaatatcaactttaa

DBGET integrated database retrieval system