KEGG   Staphylococcus pseudintermedius ED99: SPSE_0577Help
Entry
SPSE_0577         CDS       T02008                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPSE_0577 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sdt03011]
    SPSE_0577 (rplV)
Ribosome [BR:sdt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SPSE_0577 (rplV)
  Bacteria
    SPSE_0577 (rplV)
  Archaea
    SPSE_0577 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 BAT
Motif
Other DBs
NCBI-ProteinID: ADX75910
Position
648796..649149
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKDVREAVAILKLTNKASSPVVEKLLMSALANAEH
NYGMNTDQLVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGQEEAQEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaactatcagaatcgcacctcgtaaagttcgattagta
ttggatctcattcgaggtaaagacgtaagagaagcagtagctattttgaaattaacaaat
aaagcttcttctccagtagtagaaaaattattaatgtccgctttagctaatgcagagcac
aactatggtatgaacactgatcaattagttgttaaagaagcatacgctaacgaaggacca
acattgaaacgtttccgtccacgtgcacaaggacgtgcaagcgcaattaacaaaagaaca
agtcatatcactatcgtagtaagtgatggacaagaggaagctcaagaagcttaa

DBGET integrated database retrieval system