KEGG   Staphylococcus pseudintermedius ED99: SPSE_1442Help
Entry
SPSE_1442         CDS       T02008                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00260  Glycine, serine and threonine metabolism
sdt00750  Vitamin B6 metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01230  Biosynthesis of amino acids
Module
sdt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPSE_1442 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPSE_1442 (thrC)
Enzymes [BR:sdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPSE_1442 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADX76702
Position
complement(1473738..1474802)
Genome map
AA seq 354 aa AA seqDB search
MKLWKGLVEEYKAFLPVDENTPTVTLNEGHTPLIYCDTMSEMLGIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKMVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEVAEDGEIELVNSVNPYRIEGQKTSAFEIVEQLDDQAP
DILAIPVGNAGNITAYWKGFKTYEEKYQTGLPHMFGFQAAGAAPIVNNQVVKNPETIATA
IRIGNPASWKQAVQAIEESDGLIEAVTDEEILEAYQLMTSKEGIFSEPASNASIAGLIKL
HRQGKLPQGKKVVAVLTGNGLKDPDTAIGLLENPIQALPNHKESIVQYIKDALK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatggaaaggtcttgttgaagaatacaaagcatttctaccagtagatgaaaac
acaccaacagtgacgttaaatgaagggcatacgccactcatttattgtgacacgatgtca
gagatgttaggcattgaactttatgttaaatatgaaggcgctaatccaactggttcattc
aaagatcgaggcatggtcatggcagtcacaaaagcgaaagagcaaggcaagaaaatggtg
atctgtgcctcgacagggaatacatcagcttctgctgcggcatatgcggcgcgtgcaggt
ttaaaagcgattgtcgttattcctgaaggtaagattgctttaggaaagttatcgcaagct
gttatgtatggtgctgaaatcgtctctattgaaggaaactttgacgaagcgttagaaatc
gttaaagaagttgctgaagatggagaaatcgaattagtcaactcagtcaacccgtatcgt
attgaaggtcaaaaaacgagtgcttttgaaattgttgagcagttagatgaccaagcacca
gatattttagctattccagtaggtaacgccggaaatattactgcatattggaaaggtttt
aaaacgtacgaagaaaaatatcaaacaggcttaccacatatgtttggattccaagcggct
ggtgctgcacctatcgttaacaatcaagtcgttaagaaccctgaaacaatagctacagcg
attcgtatcggtaatcctgcaagttggaagcaagcagttcaagcgattgaagaatctgac
ggtttaattgaagcagtcacagatgaagaaattttagaagcgtatcaactgatgacttct
aaagagggtatttttagcgaacctgcaagtaacgcatcgatagccggacttattaaatta
catcgccaaggaaaattgcctcaaggtaaaaaagtggttgcagttttaactggaaatggt
ttgaaagatccggatacggcgattggtttattagaaaatcctattcaagcattaccaaat
cataaagaaagtatcgttcaatacattaaggacgcgttaaaatga

DBGET integrated database retrieval system