KEGG   Staphylococcus pseudintermedius ED99: SPSE_1675Help
Entry
SPSE_1675         CDS       T02008                                 

Gene name
pyc
Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00020  Citrate cycle (TCA cycle)
sdt00620  Pyruvate metabolism
sdt01100  Metabolic pathways
sdt01120  Microbial metabolism in diverse environments
sdt01200  Carbon metabolism
sdt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSE_1675 (pyc)
   00620 Pyruvate metabolism
    SPSE_1675 (pyc)
Enzymes [BR:sdt01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     SPSE_1675 (pyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp_3 HlyD_D23 RnfC_N HlyD_3 ATP-grasp_4 GARS_A GCV_H NQRA ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADX76930
Position
complement(1712835..1716284)
Genome map
AA seq 1149 aa AA seqDB search
MKRIHKLLVANRGEIAIRIFRAATELNIKTVAIYSKEDMGALHRYKADESYLVGENLGPA
ESYLNIEQIIKVAKEANVDAIHPGYGFLSENMQFAQRCAEEGIVFIGPHVEHLDMFGDKV
KARATAIKADLPVIPGTDGPVAGFEEAQTFAEKAGFPLMIKATSGGGGKGMRIVREPSEL
QEAFTRAKSEAEKSFGNSEVYIEKFIDQPKHIEVQVMGDEAGNIIHLYERDCSVQRRHQK
VVEVAPSVSLPDNLREQICEAAVDLMRQIQYVNAGTVEFLVSGNEFYFIEVNPRVQVEHT
ITEMITGVDIVKTQILIADGQLLHDDAIAMPQQSDIRTLGYAIQCRITTEDPTQDFMPDT
GRIVAYRSSGGFGVRLDAGDAFQGAEISPYYDSLLVKVSTHAISYKEAREKMARSLQEMR
IRGVKTNIPFLRNVIQHAKFASGDYTTKFLEEAPELFTIKTSRDRGTKTLEYIGNVTING
FPSVEKRPKPHFEKPHIPTTDTKAIASLSGTKQLLDAKGPDAVTAWVKAQEDVLLTDTTF
RDAHQSLLATRVRTHDLLKIAPETAQVMKDNFSLELWGGATFDVAYNFLKENPWERLEKL
RKAIPNVLFQMLLRASNAVGYRNYPDNVIQKFIAESADAGIDVFRIFDSLNWLEQMKVAN
EAVQKAGKISEGTICYTGDILNPERSNIYTLDYYVKLAKELEREGFHMLAIKDMAGLLKP
RAAYELIGELKAAVDLPIHLHTHDTSGNGILTYKEAIEAGVDVIDTAVAAMSGLTSQPSS
NSLYYAMSGFERNIRMDIEGHETLSHYWDAVRPYYSDFESDMKSPHTEIYQHEMPGGQYS
NLRQQAKSLGLGERFSEVKDMYRRVNFLFGDIVKVTPSSKVVGDMALYMVQNELDETSVI
EQGHKLDFPESVVSFFRGDIGQPVNGFNETLQRVILKGQQPLTARPGEYLAPIDFEALRE
ELQEKQQAQVTEQDLISYALYPKVYEQYMQTYEMFGNVSKLDTPTFFFGMRNNEKIQIEI
DKGKILIVELKTITEPDENGVRTVFFDMNGQARRIQVKDENIQTSHLAKMKADKSNPNHI
GAQMPGTIIEVNVAEGDQVEAGQSLIISEAMKMETTVQAPFKGTISKIYVAANDSVETQD
LLIEIEPEV
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtatacataaattattagtcgctaaccgcggtgaaattgccattcgaattttt
cgagccgcaacagaattgaatattaaaacggtagctatttattctaaggaagatatgggg
gcattacaccgatataaagcggacgagtcttatttagtcggtgaaaacttaggtccagca
gaaagttatttgaatattgaacagatcattaaagttgctaaagaggcaaatgttgatgcc
atccaccctggttatgggtttttgagtgaaaatatgcagtttgctcaacgctgtgctgaa
gagggaattgtttttatcggtccacatgtcgaacatttagatatgtttggggataaagtg
aaagcacgtgccactgcaattaaagctgatttgcctgtgattccaggtacagatggccct
gtggcaggatttgaagaggcacaaacgtttgcggaaaaagccggctttccgttgatgatt
aaagcaacaagtggcggtggcggtaaagggatgcgtatcgtcagagaaccatctgaatta
caagaggcgttcactcgtgctaaatctgaagcagaaaagtcatttggcaatagtgaagtg
tatattgaaaaatttattgatcaaccaaaacatattgaagtacaagtgatgggtgacgaa
gcgggcaacatcattcacctttatgaaagagactgctcggttcaacgccgtcatcaaaaa
gtggttgaagtagccccatcagtcagcttaccagataatttgcgcgaacaaatttgtgaa
gcggctgtcgatttaatgcgccaaattcaatacgtgaatgcaggaacggttgaattttta
gtttctggcaacgaattttactttattgaagtgaatccacgtgtacaagttgaacatacc
attacggaaatgattacgggtgtcgacattgttaaaacacaaattttgattgcagatggc
cagttattacatgacgacgcgattgcaatgccgcaacaaagtgatattcgcacgttaggt
tacgcaattcaatgccgtattacgactgaagatccaacgcaagatttcatgccggataca
gggcgtatcgtggcctaccgatcgagtggagggttcggtgtccgtttagatgctggcgat
gcattccaaggggcagaaatttcaccgtattacgattcactactcgttaaagtgtctacg
catgcaatcagttataaagaagcaagagaaaaaatggcacgctctcttcaagaaatgcgt
attcgtggtgtgaaaacgaatattccatttttacgtaatgtgattcaacatgccaagttt
gcttcgggtgattacacgacgaaatttttagaagaggcaccagagttattcacaattaaa
acgtcacgtgatagaggtacaaaaacgttagaatatatcgggaatgtaacaattaacggc
tttccaagtgttgaaaaaagaccgaagcctcatttcgagaaacctcatattccgacgaca
gatacgaaggcgattgcttcattaagtggtacgaaacaattacttgatgcaaaagggcct
gatgccgtaacagcatgggtgaaagcacaagaagacgtattgctcactgatacgacattc
cgtgatgcacatcaatctttgctcgcaacacgtgtgagaacgcatgatttactcaaaatt
gccccagaaactgcacaagtgatgaaagataacttctcacttgaattatggggtggcgcg
acgtttgatgtcgcctataatttcttgaaagaaaatccatgggaacgtctcgaaaaatta
agaaaagccattccgaatgtgttattccaaatgttattacgtgcttctaatgcagtcggt
tatcgcaattaccctgacaatgtcattcaaaagtttattgcggaaagtgccgatgcaggg
atcgacgtctttagaatatttgactcattgaactggttagaacaaatgaaagtcgctaac
gaagcagtccaaaaagccggtaaaatttctgaaggaacgatttgttatacaggtgatatt
ttaaatcctgaacgttctaatatttatacgttggactactatgtaaaactcgcgaaagag
ctagagcgtgaaggtttccatatgttagcgattaaagatatggcaggattattgaaacca
agagccgcctatgagttaatcggtgaattgaaagcagctgttgacctgccgattcacctt
catacacacgatacgagcggtaacggaatcctcacttataaagaagcaatcgaagcgggc
gttgacgtcattgatacggcagttgcggcaatgtcaggtttaacaagtcaaccaagtagt
aattcattgtattatgccatgagtggttttgaacgtaatattcgtatggatattgaaggc
catgaaacactttcgcattattgggatgcagtacgtccgtattatagtgattttgaaagt
gatatgaagtcgccacatacagaaatttatcaacatgaaatgccagggggccaatattct
aacttacgacaacaagcgaaaagtttaggactcggtgaacgtttcagtgaagtgaaagac
atgtaccgacgtgtcaacttcctcttcggtgatattgtgaaagtgacaccatcatcaaaa
gtagtcggcgatatggcgctctacatggtacaaaatgaattggatgaaacgtctgtaatc
gagcaaggccataagttagatttccctgaatctgtggtctctttctttagaggcgatatt
ggtcagccagtgaatggatttaacgagacattgcaacgggtcattttaaaaggccaacaa
ccattaactgcacgtcccggtgaatatttagcaccgattgatttcgaagctttacgcgaa
gaattacaagaaaagcaacaagctcaagtgacggaacaagacttaatcagctatgcattg
tatccaaaagtgtacgaacaatatatgcaaacttatgaaatgtttggcaatgtttcaaag
ttagatacaccaacattcttcttcggtatgcgtaacaacgagaaaattcaaatcgaaatt
gataaaggtaaaattttaatcgttgagttgaaaaccattacagaacctgatgaaaatggt
gtgcgtactgtattctttgatatgaatggtcaagcgcgtcgtattcaagtgaaagacgaa
aatattcaaacgtcccatttagcgaaaatgaaggcagataagagcaatccaaaccatatc
ggtgcacaaatgccgggtacgattattgaagtaaatgtcgctgaaggagatcaagttgaa
gcggggcaatcactcattattagtgaagcaatgaagatggaaacaacagtacaagcgccg
tttaaaggaacgatttcaaaaatttatgtggctgcaaacgatagcgtcgaaacccaagat
ttactcattgaaattgaaccagaagtatag

DBGET integrated database retrieval system