KEGG   Staphylococcus pseudintermedius ED99: SPSE_2197Help
Entry
SPSE_2197         CDS       T02008                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00071  Fatty acid degradation
sdt00280  Valine, leucine and isoleucine degradation
sdt00310  Lysine degradation
sdt00362  Benzoate degradation
sdt00380  Tryptophan metabolism
sdt00620  Pyruvate metabolism
sdt00630  Glyoxylate and dicarboxylate metabolism
sdt00640  Propanoate metabolism
sdt00650  Butanoate metabolism
sdt00900  Terpenoid backbone biosynthesis
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
sdt01212  Fatty acid metabolism
sdt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPSE_2197 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SPSE_2197 (vraB)
   00640 Propanoate metabolism
    SPSE_2197 (vraB)
   00650 Butanoate metabolism
    SPSE_2197 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPSE_2197 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SPSE_2197 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPSE_2197 (vraB)
   00310 Lysine degradation
    SPSE_2197 (vraB)
   00380 Tryptophan metabolism
    SPSE_2197 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPSE_2197 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPSE_2197 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPSE_2197 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdt04147]
    SPSE_2197 (vraB)
Enzymes [BR:sdt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPSE_2197 (vraB)
Exosome [BR:sdt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPSE_2197 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADX77433
Position
complement(2254555..2255700)
Genome map
AA seq 381 aa AA seqDB search
MTKAVIVAAKRTPIGVYGGQLQKWEPEHLLKPLFEHFEATLSCSLNDLDDVILGNIVGKG
GNIARKSLLEAGIDVSVPGLTVDRQCGSGLEAIHLASRLVESGAGDFYIAGGVESTSRAP
WKMEKPTSLYPTTPPTFYERAPFAPVGQDPTMIEAADNVAKQYDVSREDQDRFAVQSHHR
ASKAIATGAMSAEILPLIVKGQQMIQDESVKPHLQYERIARLKPLREGGTVTVGNCCLKH
DGACLVVVMSEQKARELGMSEGLMFMDYAVEGVDPHVLGIGPVPAVQRILERQQRTIDQI
DAVELNEAFSAQVLASARALNIQEAQLNRYGGAIAIGHPYSASGAILVTRLFYMKDAQST
IATMGIGGGMGNAALFERWRP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagcagtcattgttgcagcaaaacggacaccaattggcgtgtatggcggtcaa
cttcaaaaatgggagccggagcatctactgaaaccgttattcgaacattttgaagcgaca
ttatcttgttcactcaatgatttagatgacgtcattctcggtaatattgtcggtaaaggg
ggcaatattgcgcgaaaaagtttgctcgaggcagggatagatgtgtctgttccaggtctc
acggttgatcgtcaatgcggttcgggccttgaagcaattcatttggcgagtcgactcgtt
gaaagcggtgcaggagacttttatattgcagggggtgtcgaaagtacgagtcgtgcacct
tggaaaatggaaaagccgacatcactgtatccaacgacacctccgacattttatgagcgt
gcgccatttgcgccagtaggtcaagatccgactatgattgaagcggcagacaacgtggca
aaacagtatgatgtgtcacgtgaagaccaagatcgttttgcggttcaaagccatcatcgt
gcaagtaaagcgattgcgacaggtgcgatgtcagctgaaatattgccactaatagtgaaa
ggtcagcaaatgatacaagatgaaagtgttaagccgcatcttcagtatgagcggattgca
cggttaaagccattacgtgaaggtgggacagtgacagtcggtaattgttgtctcaaacac
gacggcgcctgtctagttgtcgtcatgtctgaacaaaaagcacgcgaactcggtatgtcg
gaaggtctgatgtttatggattatgcggttgaaggggtggatccacatgtattaggcatc
ggtcctgtacccgcagtgcagcgcattttagaacgacaacaacggacgatagaccaaatt
gatgccgtagaattgaatgaagcttttagcgcgcaagtgttagcgtctgcacgtgcgttg
aacattcaagaggcgcaattgaatcgttacggtggtgcgattgcgatcggtcatccgtat
agtgcgagtggtgcgattttagtgacccgtctgttttacatgaaagatgcacaaagtacc
attgcgacaatgggcattggagggggcatgggcaatgcagcactttttgaacgttggcga
ccgtga

DBGET integrated database retrieval system