KEGG   Staphylococcus pseudintermedius ED99: SPSE_2199Help
Entry
SPSE_2199         CDS       T02008                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00010  Glycolysis / Gluconeogenesis
sdt00260  Glycine, serine and threonine metabolism
sdt00680  Methane metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
sdt01230  Biosynthesis of amino acids
Module
sdt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sdt_M00002  Glycolysis, core module involving three-carbon compounds
sdt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSE_2199
  Energy metabolism
   00680 Methane metabolism
    SPSE_2199
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPSE_2199
Enzymes [BR:sdt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPSE_2199
Membrane trafficking [BR:sdt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SPSE_2199
Exosome [BR:sdt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPSE_2199
  Exosomal proteins of melanoma cells
   SPSE_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ADX77435
Position
complement(2257257..2257943)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSVWNAENLFTGWADVDLSEQGHNEAITSGKKLKEQDIHIDIAFTSLLKR
AIKTTFHLLNESDQLYVPVVKSWRLNERHYGGLQGLNKDEARQQFGEEQVHIWRRSYDTP
PPAQDEAQRERYLKDRKYELLDRRVMPESESLKDTLVRVIPYWNDQISQELLADKTVLVA
AHGNSLRALIKYLEGVSDEDIVGYEIKTGAPLIYELTDDLKVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacttattttatgtagacacggacaaagcgtctggaatgctgaaaacttattt
acaggatgggcagacgtcgatttatccgaacaaggtcacaacgaagccatcacatcagga
aaaaaattgaaagaacaagacattcatattgatattgcatttacctcgttattaaagcgt
gcgattaagaccacgtttcatttattaaatgagtctgatcaactctacgtacccgttgtt
aaatcgtggcgtttaaatgaacgtcattacggtggtttacaaggattaaataaagatgaa
gcacgtcagcaatttggtgaagaacaagtccatatttggagacgttcttacgatacacct
ccgccagcacaagatgaagcacaacgcgagcgctatttaaaagatcgcaaatacgaatta
ttagatagacgcgtgatgcctgaatctgaaagtttgaaagatactttggtgcgtgtcatc
ccatattggaacgaccaaatttctcaagaattattagctgataaaacagtacttgtagcg
gcccatggaaactcattacgtgctttgattaaatatttagaaggcgtatcagatgaagat
atcgtcggctatgaaattaaaacaggtgcgccactgatttacgaattgacagatgattta
aaagttattgacaaatattatttataa

DBGET integrated database retrieval system