KEGG   Seriola dumerili (greater amberjack): 111216372Help
Entry
111216372         CDS       T05606                                 

Gene name
ppil6
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like 6
  KO
K12739  peptidyl-prolyl cis-trans isomerase-like 6 [EC:5.2.1.8]
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sdu03110]
    111216372 (ppil6)
Enzymes [BR:sdu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111216372 (ppil6)
Chaperones and folding catalysts [BR:sdu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    111216372 (ppil6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 111216372
NCBI-ProteinID: XP_022593602
Position
Unknown
AA seq 293 aa AA seqDB search
MDSKVHIEIVGLIKDSNFHVAKSIAEGLKQKFPEAFLDPKIQPLLEFDWHTYLCNKKREL
RGEVWQYSSGLMCFLNGVLLGNEKDFASWAKNQWSFTFARPEAFYTALTEDYYSKHLQKT
GHQFVFMDIDIAGEAVGRLLFELFSDVCPKTSKNFEALCTGEQGLSQSGFPLCYKGSLFH
RVVPNGWVQGGDISPESKGNGGESIYGPTFEDESFAVSHSKRGTLGMASKGPHSNGSQFY
ITLQPTLWMDRTYVAFGQVVEGVDVLKRLEEAQTCNERPKYECKVTDCGVIKL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggactcaaaagttcatatagaaattgtcggcttaattaaagacagtaatttccatgtc
gccaaaagtattgctgagggtctaaagcagaagtttccggaggcatttctggacccaaaa
attcaacctttacttgaatttgactggcacacttatttgtgcaacaaaaaaagggagctg
cgtggtgaagtgtggcagtactccagcggcctgatgtgctttctgaacggcgttctactc
ggtaatgagaaggatttcgccagctgggccaaaaatcagtggagcttcactttcgctcgg
ccagaggctttctatacggctctaactgaggactactactccaaacacctccagaaaact
gggcatcagtttgtcttcatggatattgatatagcaggagaagcagtggggaggttgttg
tttgagctgttctcagatgtttgtccaaagacatcaaagaactttgaagctctgtgcaca
ggagagcaaggattgtcacagagcggcttcccactctgctacaagggctctctatttcat
cgggtagtgcccaatgggtgggtgcaaggcggagatatttctcctgaaagtaaaggtaat
ggaggcgaatcaatctatggaccaacatttgaagatgagagttttgctgtctcccactca
aagcgggggactctaggaatggccagtaagggtccccacagcaacggatcccagttttac
atcaccctgcagccaacactctggatggacaggacctatgtcgcctttggacaagtggtt
gaaggtgttgatgtcctcaagagattggaagaggcccaaacttgcaatgaaagacccaaa
tatgaatgtaaagttacagattgtggagtaataaagctatag

DBGET integrated database retrieval system