KEGG   Seriola dumerili (greater amberjack): 111216550Help
Entry
111216550         CDS       T05606                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04260  Cardiac muscle contraction
sdu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111216550
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111216550
   04261 Adrenergic signaling in cardiomyocytes
    111216550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sdu04040]
    111216550
Ion channels [BR:sdu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111216550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Sensor_TM1
Motif
Other DBs
NCBI-GeneID: 111216550
NCBI-ProteinID: XP_022593798
Position
Unknown
AA seq 332 aa AA seqDB search
MRLCNRGVMMLLTTAGAFCAFSLMTIAVGTDYWLYSRGMCRSKNLNDNETVRKNEEVLTH
SGLWRTCCTEGTFRGVCKDIDHFAEDGDYEQDAAEYLLRAVRASSLFPILSVGLLFLGGV
CVAASEFYKSRYNVILSAGILFVSAGLSNIIGIIVYISANSGDPSQSDNKKSYSYGWSFY
FGALSFVLAEMVGVLAVHVFIEKHRQLRTKGRPSLIKPPISRSSSYYRNRYYQNRSRRYS
YRSNHSAGDSTSHSFRASLVQEREPSLSTESKLTGMAAPLTVGSEFMLYTLTSPLKDGKI
DVAVDDLTTAVAHNNTDILPGNCAANRRTTPV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgtgtaaccggggtgtgatgatgctgctgaccacggcgggggctttctgcgcc
ttcagcctcatgaccatcgccgtgggcacggactactggctgtactcccgcgggatgtgc
cgctccaagaacctgaacgacaacgagaccgtccgcaagaacgaggaagtcctgacccac
tccggtctgtggaggacctgctgcacggaggggacgtttcggggtgtttgcaaagacatt
gatcactttgctgaagatggagactatgagcaggatgctgcagaatatttactgcgagca
gttcgggcctccagcctcttccccatcctcagtgtggggttattatttctcggaggtgtg
tgtgtagctgccagtgagttctacaagtcacgctacaatgtcattctcagcgcgggtata
ctctttgtctctgcaggtctcagtaacatcattggcatcattgtgtacatatcagccaac
tcaggcgaccccagccagagcgacaacaagaagagctactcctacggctggtctttctat
tttggggctttgtccttcgtgctggctgagatggtgggcgtcctggcagtgcatgtgttc
atagagaagcacaggcagctgcgcacgaaaggtcggccttccctcatcaagccacccatc
tcccgtagctcatcttactaccgcaaccgatactaccagaaccgcagccgccgatacagt
tacaggagcaaccacagcgcgggggactccacctcacactcttttcgagcgtccttggtg
caagagcgagagccgtccctctccaccgaatccaaactcaccggcatggcagcgccactg
acagtgggctcagagttcatgctttacaccttaacctcgccactcaaagacggtaagatt
gacgtggctgtggatgatttaactactgcagtcgctcacaacaacacagacattctgcct
ggaaactgtgctgccaacagaaggaccacgcctgtgtga

DBGET integrated database retrieval system