KEGG   Seriola dumerili (greater amberjack): 111216681Help
Entry
111216681         CDS       T05606                                 

Gene name
gatb
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial isoform X1
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00970  Aminoacyl-tRNA biosynthesis
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111216681 (gatb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sdu03029]
    111216681 (gatb)
Enzymes [BR:sdu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     111216681 (gatb)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     111216681 (gatb)
Mitochondrial biogenesis [BR:sdu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    111216681 (gatb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 111216681
NCBI-ProteinID: XP_022594017
Position
Unknown
AA seq 548 aa AA seqDB search
MAASSIAASELLHKMNKQISILYPKASCVIRRIGTTSSRCHSQPQHRAKSAPQQLVGVVG
LEIHAQINSNTKLFSGSPVRFSSPPNSLVSFFDGSLPGTLPVLNRRCVEAAVMTGLALNC
TINRKSVFDRKHYFYADLPAGYQITQQRRPIAIDGILTYSLLGGKRSEVIRKTVNIKQIQ
LEQDSGKSLHDDVRSQTLIDLNRAGVGLMELVMEPDMSCGEEAAAAVRELQLILQALGTC
QGNMSEGQLRVDANVSVHRPGEPLGIRTEVKNINSIRFLARAIDYEIQRQIGVLQRGGTV
QNETRAYDSKSGETIPMRDKEGLQDYRFMPEPNLPPLIVYEDNASLPTGFDACQAVVVQK
IREGLPELPSVKRDRLVQTYGILPEHSFTLVNEDGLVDYFEAVLKATKKEPRKVIGWVTN
ELLGHLKQQDMSVSQSPVSAPALAELLDLQETGHISSSVAKQVFQEMWRSSGKTAQQIIQ
EQDLGLVSDTAQLHSICQKVVDSHPDEVRAFRNGNKKVLNKLMGLVQRETKGRTDPVLVR
TILQEKTL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcctctattgcagcgagtgagctgctacataaaatgaataaacaaatatcg
atattgtacccaaaagcttcgtgtgtaattagacgaataggcacaacaagctcacgatgt
catagtcaaccacagcatagagcaaaaagtgctccccagcagctggttggggtggtcggc
ttggagatccatgcccagattaactccaacaccaagctgttttctggctcaccagttcgc
ttctcatcccctccaaactccctggtgtcattctttgatggatccttacctggcacatta
cctgttctgaacagacgatgtgtcgaggctgcagtgatgacagggctggctctcaactgc
accataaacaggaagtcagtttttgacaggaaacattacttctacgctgatctccctgct
ggataccagatcactcagcagcggcggcccattgcaatagatggcatactgacttacagc
ctccttggaggaaaaaggagtgaagtgatcagaaaaactgtcaacataaaacagattcag
ctggagcaggacagtggcaagagtctccatgatgacgtgcgcagccagacactcatagac
ctcaacagagcaggtgtaggtctaatggagctagtgatggagccagacatgagctgtgga
gaggaggctgctgccgctgtcagagagcttcagctcatcctgcaagccctgggcacctgt
caaggcaacatgtctgagggccagctgagagtagatgccaacgtgtctgtccacagacca
ggtgagcccctgggcatcaggactgaggtgaagaacatcaacagcatccgattcctggcc
agggctatagactacgagattcagagacagatcggtgtcctgcagagagggggaacggtg
caaaatgagacccgggcatacgattccaaatcaggggagactatccccatgagggacaaa
gagggtcttcaggactacaggttcatgccagagcccaacctaccccctctgattgtgtat
gaggataacgcgtcgctgcccaccggctttgatgcgtgccaggccgtggtggtgcagaag
ataagagaaggcctgccagaactacccagtgtcaaaagagacaggctggttcaaacatac
ggcatcctgcccgagcacagcttcactctggtgaacgaggatgggctggtggactacttt
gaggcggtgttgaaagctaccaagaaggagccaaggaaggtgattggctgggtgacaaat
gagctgttgggtcacctcaaacagcaagacatgagtgtgagccagagcccagtctctgct
cctgcactagctgagctgctggacctccaagaaacaggacatatctcctcttcggttgcc
aagcaggtgttccaggagatgtggaggtcatcaggcaagacggcccagcagatcatccag
gagcaggacttggggcttgttagtgacactgcacagctgcacagcatctgccagaaggtg
gtggactcgcatcctgatgaggttcgcgccttcagaaatggaaacaagaaagttctgaac
aaactgatgggcctggttcagagggagaccaaaggcagaactgacccagttctggtgagg
acaattttacaagagaagactttgtga

DBGET integrated database retrieval system